SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000014020 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000014020
Domain Number 1 Region: 663-813
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.2e-37
Family Toll/Interleukin receptor TIR domain 0.0000552
Further Details:      
 
Domain Number 2 Region: 396-632
Classification Level Classification E-value
Superfamily L domain-like 2.72e-35
Family Ngr ectodomain-like 0.023
Further Details:      
 
Domain Number 3 Region: 32-254
Classification Level Classification E-value
Superfamily L domain-like 5.95e-34
Family Ngr ectodomain-like 0.019
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000014020
Domain Number - Region: 267-408
Classification Level Classification E-value
Superfamily L domain-like 0.000112
Family Internalin LRR domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000014020   Gene: ENSRNOG00000010522   Transcript: ENSRNOT00000014020
Sequence length 835
Comment pep:known chromosome:RGSC3.4:5:83564096:83577731:1 gene:ENSRNOG00000010522 transcript:ENSRNOT00000014020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPLLHLAGTLIMALFLSCLRPGSLNPCIEVLPNITYQCMDQNLSKIPHDIPYSTKNLDL
SFNPLKILRSYSFSNFSQLQWLDLSRCEIETIEDKAWHGLNQLSTLVLTGNPIKSFSPGS
FSGLTNLENLVAVETKMTSLEGFHIGQLISLKKLNVAHNLIHSFKLPEYFSNLTNLEHVD
LSYNYIQTISVKDLQFLRENPQVNLSLDLSLNPIDSIQAQAFQGIRLHELTLRSNFNSSN
VLKMCLQNMTGLHVHRLILGEFKNERNLESFDRSVMEGLCNVSIDEFRLTYINHFSDDIY
NLNCLANISAMSFTGVHIKHIADVPRHFKWQSLSIIRCHLKPFPKLSLPFLKSWTLTTNR
EDISFGQLALPSLRYLDLSRNAMSFRGCCSYSDFGTNNLKYLDLSFNGVILMSANFMGLE
ELEYLDFQHSTLKKVTEFSVFLSLEKLLYLDISYTNTKIDFDGIFLGLISLNTLKMAGNS
FKDNTLSNVFTNTTNLTFLDLSKCQLEQISRGVFDTLYRLQLLNMSHNNLLFLDPSHYKQ
LYSLRTLDCSFNRIETSKGILQHFPKSLAVFNLTNNSVACICEYQNFLQWVKDQKMFLVN
VEQMKCASPIDMKASLVLDFTNSTCYIYKTIISVSVVSVLVVATVAFLIYHFYFHLILIA
GCKKYSRGESIYDAFVIYSSQNEDWVRNELVKNLEEGVPRFQLCLHYRDFIPGVAIAANI
IQEGFHKSRKVIVVVSRHFIQSRWCIFEYEIAQTWQFLSSRSGIIFIVLEKVEKSLLRQQ
VELYRLLSRNTYLEWEDNALGRHIFWRRLKKALLDGKALNPDETSEEEQEATTLT
Download sequence
Identical sequences G3V7D8
ENSRNOP00000014020 ENSRNOP00000014020 10116.ENSRNOP00000014020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]