SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015679 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015679
Domain Number 1 Region: 224-479
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.43e-63
Family Eukaryotic proteases 0.00000015
Further Details:      
 
Domain Number 2 Region: 50-165
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-22
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000015679
Domain Number - Region: 187-233
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000156
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015679   Gene: ENSRNOG00000011718   Transcript: ENSRNOT00000015678
Sequence length 483
Comment pep:known chromosome:RGSC3.4:4:160693497:160708614:1 gene:ENSRNOG00000011718 transcript:ENSRNOT00000015678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSRGLVPELENNLWSSPNTSCVGKMCWLLLWGILHTCPTQASVLLAQQFPQQLTSPGY
PEPYIKGQESHADIEAPEGFAVRLIFQDFDLEPSPGCEGDSVTISTRGTDATRLCGQQGS
SLGSPPNQMEFVSSGRSLRLTFRAHSSKNKVTHLHKGFLALYQAIAVSQPNGDAEAFTTP
GANPPEIQNHCPGPYYKEEQTGTLSCPSSRKWKDRQRGEEVPECVPVCGRPVVPIAENPN
TFGSSRAKPGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIFPKDSIYLRKNKTVNVFLG
HTDVDELLKLGNHPVRRVVVHPDYRQEESHNFDGDIALLELEHRVPLGPSLLPVCLPDNE
TLYHSGLWGYISGFGVEMGWLTTKLKYSKLPVAPREACEAWLRQRQRTEVFSDNMFCVGE
EMQVNSVCQGDSGSVYVVWDDRALRWVATGIVSWGVGCGKGYGFYTKVLSYVDWIKGVIE
CKD
Download sequence
Identical sequences 10116.ENSRNOP00000015679 ENSRNOP00000015679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]