SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000015918 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000015918
Domain Number 1 Region: 408-495
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000618
Family DEATH domain, DD 0.0072
Further Details:      
 
Domain Number 2 Region: 65-109
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000115
Family TNF receptor-like 0.0032
Further Details:      
 
Domain Number 3 Region: 129-186
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000457
Family TNF receptor-like 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000015918
Domain Number - Region: 594-650
Classification Level Classification E-value
Superfamily DEATH domain 0.011
Family Caspase recruitment domain, CARD 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000015918   Gene: ENSRNOG00000011517   Transcript: ENSRNOT00000015918
Sequence length 655
Comment pep:known chromosome:RGSC3.4:9:13587961:13666380:-1 gene:ENSRNOG00000011517 transcript:ENSRNOT00000015918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSASSITALASCSRIAGQVGATMVAGSLLLLGFLSTITAQPEQKTLSLTGTYRHVDRT
TGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPSGTFTRHENGIERCHDCSQPCPRPMIER
LPCAALTDRECICPPGMYQSNGTCAPHTVCPVGWGVRKKGTENEDVRCKQCARGTFSDVP
SSVMKCRAHTDCLGQNLMVVKQGTKETDNVCGVHLSSSSTTPSSPGIATFSHPEHTESHD
VPSSTYEPQGMNSTDSNSTASVRTKVPSDIQEETVPDNTSSTSGKESTNRTLPNPPQLTH
QQGPHHRHILKLLPSSMEATGEKSSTAIKAPKRGHPRQNPHKHFDINEHLPWMIVLFLLL
VLVLIVVCSIRKSSRTLKKGPRQDPSAIMEKAGLKKSLTPTQNREKWIYYRNGHGIDILK
LVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLIS
ALRQHRRNDVVEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPSPNVKLENSTLLTVEP
SPLDKNKGFFVDESEPLLRCDSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIF
DDMLHILNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLL
Download sequence
Identical sequences D3ZF92
ENSRNOP00000015918 10116.ENSRNOP00000015918 NP_001101677.1.100692 NP_001101677.1.4139 ENSRNOP00000015918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]