SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016420 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016420
Domain Number 1 Region: 331-576
Classification Level Classification E-value
Superfamily Kelch motif 6.54e-46
Family Kelch motif 0.00017
Further Details:      
 
Domain Number 2 Region: 146-233
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000243
Family BTB/POZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016420   Gene: ENSRNOG00000012333   Transcript: ENSRNOT00000016420
Sequence length 633
Comment pep:known chromosome:RGSC3.4:16:79430239:79432140:-1 gene:ENSRNOG00000012333 transcript:ENSRNOT00000016420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSVAPFVLYPGTEPRTPGEDSLPLPAEEEGAASPAQTPCSLSASLCFSSGDDSPPQSR
ASAAEGSEASPPSLRSDLRVVETQWDVSSAASPESPQECARPEEPASPEEPPSRREHARP
VELESLDELGEPVPVPPGVGSEHGEPDLVIEVAGRRLRAHKAVLAARSDYFRARASRDVL
RVQGVSFTALRLLLADAYSGCMAGVRPDNVAEVVAGARRLQLPGAAQRATEAMAPQLSLD
NCYEVLSAGKRQRLSELRDAAYRFMCDHYLEVLREPAVFGRLSGAERDLLLRRRLGTGRA
CLLAAALGTTGERSGSRPQSPSGDAESRGDAAVYCYQAEAGEWRELTRLPEGAPARGCGL
CVLFNYLFVAGGVAPAGPDGRARPSDQVFCYNPVTDCWSTVRPLRQARSQVQLLALDGHL
YALGGECLLSVERYDPRADRWTAVAPLPRGAFAVAHEAATCNGEIYVSGGSLFYRLLKYD
PRRDEWQECPCSSSRERSADMVALDGFLYRFDLCGSRGDAQAATGSGGGVSVFRYHCLAK
QWSQCAAHLRPPGAPAGLQPFRCVALDGTIYCVSRAGTWRFVPSQDTEAGSDMGPGGSFE
PEPLGSPLDVRGVLFPFVLNLPEKPDRGEQGAA
Download sequence
Identical sequences D4A5J1
10116.ENSRNOP00000016420 ENSRNOP00000016420 NP_001100796.1.100692 NP_001100796.1.4139 XP_006253452.1.100692 XP_006253453.1.100692 XP_006253454.1.100692 XP_006253455.1.100692 ENSRNOP00000016420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]