SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000016897 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000016897
Domain Number 1 Region: 9-144
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.77e-49
Family Galectin (animal S-lectin) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000016897   Gene: ENSRNOG00000012557   Transcript: ENSRNOT00000016897
Sequence length 145
Comment pep:known chromosome:RGSC3.4:10:65075523:65078686:-1 gene:ENSRNOG00000012557 transcript:ENSRNOT00000016897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSFSTQPPYPNLTVPFFTSISNGLYPSKSIVISGVVLSDAKRFQINLRCGGDIAFHLNP
RFNEKVVVRNTQINNSWGPEERSLPGSMPFSRGQRFSVWILCEGHCFKVAVDGQHICEYR
HRMMNLPDINTLEVAGDIQLTHMET
Download sequence
Identical sequences G3V7N2
10116.ENSRNOP00000016897 ENSRNOP00000016897 ENSRNOP00000016897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]