SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000017096 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000017096
Domain Number 1 Region: 166-444
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.75e-77
Family Nuclear receptor ligand-binding domain 0.00000000122
Further Details:      
 
Domain Number 2 Region: 113-197
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.32e-32
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000017096   Gene: ENSRNOG00000012499   Transcript: ENSRNOT00000017096
Sequence length 485
Comment pep:known chromosome:RGSC3.4:7:140991447:141014108:-1 gene:ENSRNOG00000012499 transcript:ENSRNOT00000017096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLALPLPPPGAGHCGGRRGNGLRVLGVLAPSFSPSRVAMYDCMESFVPGPRRLYGAAGPG
AGLLRRATGSSCFAGLESFAWAQPASLQSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVC
NDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEV
GMSKEAVRNDRNKKKKEVKEEGPPDNYELSPQLEELITKVSKAHQETFPSLCQLGKYTTN
SSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILML
RICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSA
ICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKG
AERAITLKMEIPGPMPPLIREMLENPEMFEDDSSKPGPHPKASSEDEAPGSQGKRGQSPQ
PDQGP
Download sequence
Identical sequences D3ZWV0
10116.ENSRNOP00000016801 ENSRNOP00000016801 NP_001128722.1.100692 NP_001128722.1.4139 ENSRNOP00000017096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]