SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000020697 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000020697
Domain Number 1 Region: 324-616
Classification Level Classification E-value
Superfamily Kelch motif 9.81e-72
Family Kelch motif 0.00013
Further Details:      
 
Domain Number 2 Region: 8-62,119-183
Classification Level Classification E-value
Superfamily POZ domain 1.49e-28
Family BTB/POZ domain 0.005
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000020697
Domain Number - Region: 80-109
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00994
Family beta-sandwich domain of Sec23/24 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000020697   Gene: ENSRNOG00000015418   Transcript: ENSRNOT00000020697
Sequence length 640
Comment pep:known chromosome:RGSC3.4:18:13167645:13282841:-1 gene:ENSRNOG00000015418 transcript:ENSRNOT00000020697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRS
LFSSHPPLGGGVGGQDGLGAPKDQQQQQQPQQQPSQQQQQPPQEEPGTPSSSPDDKLLTS
PRAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLN
DQISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNFEEMRALLDSLPPPVESELAL
FQMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQSVDFMRTDPVCQKLLLDAM
NYHLMPFRQHCRQSLASRIRSNKKMLLLVGGLPPGPDRLPSNLVQYYDDEKKTWKILTIM
PYNSAHHCVVEVENFLFVLGGEDQWNPNGKHSTNFVSRYDPRFNSWIQLPPMQERRASFY
ACRLDKHLYVIGGRNETGYLSSVECYNLDTNEWRYVSSLPQPLAAHAGAVHNGKIYISGK
PFFHLSLQRGVHNGEYVPWLYCYDPVMDVWARKQDMNTKRAIHTLAVMNDRLYAIGGNHL
KGFSHLDVMLVECYDPKGDQWNILQTPILEGRSGPGCAVLDDSIYLVGGYSWSMGAYKSS
TICYCPEKGTWTELEGDVAEPLAGPACATVILPACVPYNK
Download sequence
Identical sequences ENSRNOP00000020697 10116.ENSRNOP00000020697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]