SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000022713 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000022713
Domain Number 1 Region: 38-483
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.7e-98
Family Integrin alpha N-terminal domain 0.000000000729
Further Details:      
 
Domain Number 2 Region: 784-1014
Classification Level Classification E-value
Superfamily Integrin domains 9.42e-64
Family Integrin domains 0.00000491
Further Details:      
 
Domain Number 3 Region: 484-642
Classification Level Classification E-value
Superfamily Integrin domains 1.36e-47
Family Integrin domains 0.0000188
Further Details:      
 
Domain Number 4 Region: 643-777
Classification Level Classification E-value
Superfamily Integrin domains 5.23e-36
Family Integrin domains 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000022713   Gene: ENSRNOG00000016538   Transcript: ENSRNOT00000022711
Sequence length 1062
Comment pep:known chromosome:RGSC3.4:17:86427199:86649274:-1 gene:ENSRNOG00000016538 transcript:ENSRNOT00000022711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSARTHRGPPENWAPPFACLCCVSAVLGMLWSPVSLAFNLDVDKLTVYSGPEGSYFGYSL
DFYIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAERSAQCKQIPFDTTNNRKIRV
NGTKEPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLKPNPAKDPVGTCYVAIQNFSAY
AEHSPCRNSNVDPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITVSVADIIANYS
FKDILRKLAAEKQTDVAPASYDDSYLGYSVAAGEFTGDSLQELVAGIPRGAQNFGYVSII
NSTDMTFIQNFTGEQMASYFGYTVVVSDVNNDGMDDILVGAPLFMEREFESNPREVGQVY
LYLQVSALLFQDPQVLTGTETFGRFGSSVAHLGDLNQDGYNDIAIGVPFAGKDQRGKVLI
YNGNARGLHSKPSQVLQGIWGSQTIPSGFGFSLRGDADIDKNDYPDLLVGAFGEGKVAVY
RARPVVTVDAQLLLHPMIINLENKTCQIPEFPTPVACFSLRVCASIAGQSISNTVALMAE
VQLDFLKQKGAIKRTLFLHNHQSHLIFPFVMRQQKSLHCQDFMVYLRDETEFRDKLSPIN
VSLNYSLDDSTFEDGLEVKPILNHYRENVVTEQAHILVDCGEDNLCVPDLRLSARPDKQE
IIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGLRLLSCEYKMENVT
RMVVCDLGNPMVTGTNFSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSVQINV
TAVAQVEIRGVSHPPQIVLPIHNWEPAEEPHKEEEVGPLVEHIYELHNIGPSTISDSILE
VGWPFSAREEFLLYVFHLQTLGPLQCQTNPEINPQDIKPAASPEDTPELSAFLRNATIPH
LVRKRDVPVVQPHRQSPAKILNCTNIDCLQISCAVGRLGGGESAVLKVRSRLWAHTFLQR
KNDPYALASLVSFEVKKIPYKEQPAKLPAGSTAIKTSVIWATPNVSFSIPLWVIILAILL
GLLVLAILTLALWKCGFFDRARPPQDEMTDREQLTSDKTPEA
Download sequence
Identical sequences B5DEG1
NP_001167443.1.100692 NP_001167443.1.4139 ENSRNOP00000022713 10116.ENSRNOP00000022713 ENSRNOP00000022713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]