SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024609 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024609
Domain Number 1 Region: 135-272
Classification Level Classification E-value
Superfamily ISP domain 4.45e-40
Family Rieske iron-sulfur protein (ISP) 0.000000659
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 2.4e-24
Family ISP transmembrane anchor 0.0000218
Further Details:      
 
Domain Number 3 Region: 1-57
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 1.08e-21
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.0000866
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024609   Gene: ENSRNOG00000018281   Transcript: ENSRNOT00000024609
Sequence length 274
Comment pep:known chromosome:RGSC3.4:17:40429806:40434080:1 gene:ENSRNOG00000018281 transcript:ENSRNOT00000024609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVAARSGPFAPVLSATSRGVAGALRPLLQSAVPATSEPPVLDVKRPFLCRESLSGQAA
TRPLVATVGLNVPASVRYSHTDIKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTAT
TTVGVAYAAKNAVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
KKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRKGPAPLNLEVPTYEFTSGDVVVVG
Download sequence
Identical sequences P20788
ENSRNOP00000024609 NP_001008888.1.100692 NP_001008888.1.4139 ENSRNOP00000024609 10116.ENSRNOP00000024609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]