SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026691 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026691
Domain Number 1 Region: 239-265,307-509
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-60
Family Voltage-gated potassium channels 0.00071
Further Details:      
 
Domain Number 2 Region: 111-208
Classification Level Classification E-value
Superfamily POZ domain 2.59e-26
Family Tetramerization domain of potassium channels 0.0000051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026691   Gene: ENSRNOG00000019719   Transcript: ENSRNOT00000026691
Sequence length 602
Comment pep:known chromosome:RGSC3.4:4:162896283:162898091:-1 gene:ENSRNOG00000019719 transcript:ENSRNOT00000026691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEISLVPLENGSAMTLRGGGEAGASCVQTPRGECGCPPTSGLNNQSKETLLRGRTTLEDA
NQGGRPLPPMAQELPQPRRLSAEDEEGEGDPGLGTVEEDQAPQDAGSLHHQRVLINISGL
RFETQLGTLAQFPNTLLGDPAKRLHYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPV
NVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSA
RAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPPQPPAPAPGINGSVSGALSSG
PTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAEFSRNIMNIIDVVAIFPYF
ITLGTELAEQQPGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASM
RELGLLIFFLFIGVILFSSAVYFAEADNHGSHFSSIPDAFWWAVVTMTTVGYGDMRPITV
GGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGNQRRESGLDTG
GQRKVSCSKASFCKTGGSLESSDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTSRET
DL
Download sequence
Identical sequences P19024
ENSRNOP00000026691 10116.ENSRNOP00000026691 ENSRNOP00000026691 NP_037104.1.100692 NP_037104.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]