SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026699 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026699
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily DEATH domain 2.67e-24
Family Pyrin domain, PYD 0.000029
Further Details:      
 
Domain Number 2 Region: 110-192
Classification Level Classification E-value
Superfamily DEATH domain 2.24e-19
Family Caspase recruitment domain, CARD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026699   Gene: ENSRNOG00000019675   Transcript: ENSRNOT00000026699
Sequence length 193
Comment pep:known chromosome:RGSC3.4:1:187276089:187277122:-1 gene:ENSRNOG00000019675 transcript:ENSRNOT00000026699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRARDAILDALENLTADEFKKFKMKLLTAPVREGYGRIPRGALLQMDPIDLTDKLVSYY
LEGYGLELTMTVLRDMGIQELAEQLQKIMEESGAVATATSVPAQGTARTEHFVDQHRQAL
IARVTEVDGLLDALYGNVLTEGQYQAVRAETTNQNKMRKLFSFAPAWNLTCKNLFLEALR
QTQPYLVTDLEQS
Download sequence
Identical sequences G3V8L1
ENSRNOP00000026699 10116.ENSRNOP00000026699 ENSRNOP00000026699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]