SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026706 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026706
Domain Number 1 Region: 106-290
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 9.55e-51
Family Isochorismatase-like hydrolases 0.0000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026706   Gene: ENSRNOG00000019711   Transcript: ENSRNOT00000026706
Sequence length 297
Comment pep:known chromosome:RGSC3.4:18:54471690:54491596:1 gene:ENSRNOG00000019711 transcript:ENSRNOT00000026706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAEPSVAALAGGGVGAGAPSGGVPVLFCFSVFARPASVPHGAGYDVLIQKFLSLYGDQ
LDMHRKFVVQLFAEEWGQYVDLPKGFAVSERCKLRLVPLQIQLTTLGNLTPPSTVFFCCD
MQERFRPAIKYFGDIISVGQRLLQGARILGIPVIITEQYPKGLGSTVQEIDLTGVKLVLP
KTKFSMVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSRS
MMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences F2Z3T7 Q91V64
NP_079754.2.92730 XP_008772040.1.100692 ENSMUSP00000025503 10090.ENSMUSP00000025503 10116.ENSRNOP00000026706 ENSRNOP00000026706 ENSRNOP00000026706 ENSMUSP00000025503 ENSMUSP00000025503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]