SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027240 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027240
Domain Number 1 Region: 302-595
Classification Level Classification E-value
Superfamily Kelch motif 8.11e-57
Family Kelch motif 0.0001
Further Details:      
 
Domain Number 2 Region: 31-148
Classification Level Classification E-value
Superfamily POZ domain 1.67e-35
Family BTB/POZ domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027240   Gene: ENSRNOG00000020088   Transcript: ENSRNOT00000027241
Sequence length 606
Comment pep:known chromosome:RGSC3.4:16:19458655:19483636:1 gene:ENSRNOG00000020088 transcript:ENSRNOT00000027241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESGGSSGSGQSPERPSSLADRNGALKCTFSAAGHSTGLLQGLAALRAQGQLLDVVLTV
NSEAFHAHKVVLAACSDYFRAMFTGGMREASQAVIQLQGVSARGLRHIIDFAYSAEVTLD
LDCVQDVLGAAVFLQMLPVVELCEDFLKAAMSVETCLHIGQMATTFSLTSLRESVDAFTF
RHFLQIAAEEDFLRLPLERLVFFLQSNRLQSCAEIDLFRAAVRWLQHDPARRARASLVLR
HVRFPLMQPAELVDSVQTLDVMLDDALCRQYLLEAFSYHVLPCRQHDMQSPRTAVRSDVA
SLVAFGGTPYTDSDRAVSSKVFQLPEPGARHFRELTEMELGCSHAGVAVLDNFVYVAGGQ
HLQHRSGEGAVDACYRYDPQRNRWLRLRALRESRVQFQLTALGGLLYATGGRNRAGSLAS
VERYCPRRDSWDFACPLKRRTWGHAGAAAAGRLYISGGYGVSAEDKKALQCYDPAADRWE
PRAPMREPRVLHAMLGAAGRIYALGGRMDHVDRCFDVLAVEYYVPDADQWTSVTPMRAGQ
SEAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTETDEWERDLHFPESFAGIACAAVLLP
RSGHGR
Download sequence
Identical sequences D3ZH92
ENSRNOP00000027240 10116.ENSRNOP00000027240 ENSRNOP00000027240 NP_001099545.1.100692 NP_001099545.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]