SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027385 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027385
Domain Number 1 Region: 220-315
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000228
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 109-173
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000141
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027385   Gene: ENSRNOG00000020139   Transcript: ENSRNOT00000027385
Sequence length 597
Comment pep:known chromosome:RGSC3.4:2:180807414:180842877:1 gene:ENSRNOG00000020139 transcript:ENSRNOT00000027385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRSKWDQPAPAPLLFLPPAAPGGEVTSSGGSPGGASTAAPSGALDAAAAVAAKINAMLMA
KGKLKPSQNAAEKLQAPGKSLTSNKSKDDLVVAEVEINDVPLTCRNLLTRGQTQDEISRL
SGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKEIITNGVVKAATG
TSPTFNGATVTVYHQPAPIAQLSPAVNQKPSFQSGMHYVQDKLFVGLEHAVPTFNVKEKV
EGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHPKPEGLAAAKKLC
ENLLQTVHAEYSRFVNQINTAVPLPGYTQPSAISSIPPQPPYYPSNGYQSGYPVVPPPQQ
PVQPPYGVPSIVPPAVSLAPGVLPALPTGVPPVPTQYPITQVQPPASTGQSPISAPFIPA
APVKTALPAGPQPQPQPPLPAQPQSQKRRFTEELPDERESGLLGYQHGPIHMTNLGTGFS
SQNEIEGAGSKPASSSGKERERDRQLMPPPAFPVTGIKTESDERNGSGALTGSHAKKMKT
AEKGFGLVAYAADSSDEEEEHGGHKNASSFPQGWSLGYQYPSSQPRAKQQMPFWMAP
Download sequence
Identical sequences ENSRNOP00000027385 10116.ENSRNOP00000027385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]