SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027897 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027897
Domain Number 1 Region: 31-225
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.14e-34
Family Laminin G-like module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027897   Gene: ENSRNOG00000020525   Transcript: ENSRNOT00000027897
Sequence length 1737
Comment pep:known chromosome:RGSC3.4:8:19789061:19834241:-1 gene:ENSRNOG00000020525 transcript:ENSRNOT00000027897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSCRRLDQLQAGLCLLLASLQLVSWTLAAEPVDVLETLGVHRDKAGVTKGPGFCPQRIP
QGDRAFRVGKSSLLSVPTWQLFPDGHFPENFSVLLTLRAQPANQSVLLSIYDENGVRQMG
LALGPALGLLGDSFRSLPKQINLMDGRWHRVAVSISGDKVTLVVDCEPQPPMFGQGPRVI
STAGLTVMGTQELGEESFEGDIQELLLIPDPQAALQACELYLPDCETPDSTTTGVTKEEP
ETPAPRRRKGKGKKKDRGRKGKGRKKNKTSRLSPTPGAPENQTSLHTPETEKPSPHLPPT
PTPLAITTTVTMGGNATVLQGLDSSTETEQMTPEMDATEESEGGGPTMGPEFRAAEQSLQ
TEFQIFPGAGEKGAKGEPATIEQGQQFEGPAGAPGPRGISGPSGPPGPPGFPGDRGLPGP
AGLPGIPGIDGVRGLPGTVIMMPFHFASGSMKGPPVSFQQAQAQAVLQQAQLSMKGPPGP
VGLTGRPGPVGLPGYPGLKGELGEAGPQGPRGLQGPPGPPGREGKTGRAGADGARGLPGD
TGPKGDRGFDGLPGLPGEKGQRGDFGPVGQPGPPGEDGIKGLQGPPGPTGQAGEPGPRGL
IGPRGPPGPLGRPGVTGSDGAPGAKGNVGPPGEPGPPGQQGNHGSQGIPGPQGPIGTPGE
KGPPGNPGIPGVPGSEGPPGHPGHEGPTGEKGAQGPPGSAGPQGYPGPRGVKGTSGNRGL
QGEKGERGEDGFPGFKGDEGPKGDRGNPGLPGPRGEDGPEGQKGPEGLPGDEGPPGAAGE
KGKLGVPGLPGYPGRPGPKGSIGFPGPLGPLGEKGKRGKAGQPGEEGERGTPGTRGDRGQ
PGATGQPGPKGDVGQNGSPGAPGEKGLPGLQGPPGFPGPKGPPGPQGKDGIPGHPGQRGE
LGFQGQTGPPGPAGVLGPQGKVGDVGPLGERGPPGPPGPPGEPGLPGIEGREGAKGELGP
LGSLGKEGPPGPMGFPGPQGAPGDPGPIGLKGDKGPPGPLGANGSPGERGPVGPSGGIGL
PGQSGGQGPIGPAGEKGSPGERGVPGPTGKDGIPGPPGLQGPPGAAGPSGEEGDKGEVGM
PGHKGSKGDKGDAGPPGPTGIRGPAGHPGPPGADGAQGRRGPPGLFGQKGDDGVRGFVGV
IGPPGLQGLPGPPGEKGEVGDVGSMGPHGAPGPRGPPGPSGSAGSPGLPGGVGQPGAVGE
KGEPGNAGDAGPPGVPGIPGPKGEIGEKGDSGPSGAAGPPGKKGPPGEDGAKGNMGPTGL
PGDLGPPGDPGVPGTDGIPGEKGNAGDIGGPGPPGASGEPGARGLPGKRGSPGRMGPEGK
EGEKGAKGDAGPDGPPGRTGPIGARGPPGRVGPDGLPGIPGPVGEPGLLGPPGLIGPPGP
LGPPGLPGLKGDAGLKGEKGHIGLIGLIGPPGEAGEKGDQGLPGVQGPPGLQGDPGLPGP
VGSLGHPGPPGVVGPLGQKGSKGSPGSLGPRGDPGPAGPPGPPGSPAEVHGLRRRRSVLD
TPEGGLEEVMASLNSLSLELEQLQRPPGTAESPGLICHELHRNHPHLPDGEYWIDPNQGC
ARDAFKVFCNFTAGGETCLYPDKKFETVKLASWSREKPGGWYSTFRRGKKFSYVDADGSP
VNVVQLTFLKLLSAAAHQRFTYTCQNSAAWLDEASGDHRHSIRFQGTNWEELSFNQTTAA
TIKVPHDGCRVRKGQAKTLFEFSSSVGFLPLWDVAAVDFGQTNQKFGFELGSVCFSS
Download sequence
Identical sequences Q9JI04
ENSRNOP00000027897 NP_068528.1.100692 NP_068528.1.4139 10116.ENSRNOP00000027897 ENSRNOP00000027897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]