SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028360 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028360
Domain Number 1 Region: 327-608
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-84
Family Kelch motif 0.0000000000381
Further Details:      
 
Domain Number 2 Region: 53-177
Classification Level Classification E-value
Superfamily POZ domain 4.45e-30
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028360   Gene: ENSRNOG00000020878   Transcript: ENSRNOT00000028360
Sequence length 624
Comment pep:known chromosome:RGSC3.4:8:20259178:20266352:-1 gene:ENSRNOG00000020878 transcript:ENSRNOT00000028360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPEPKPSGAPRSSQFLPLWSKCPEGAGDAVMYASTECKAEVTPSQDGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYEDIPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISVGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCTELHQRAREYIYMHFGEVAKQEEFFNLSHCQLATLISRDDLNVR
CESEVFHACIDWVKYDCPQRRFYVQALLRAVRCHALTPRFLQTQLQKCEILQADARCKDY
LVQIFQELTLHKPTQAVPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHSSVERYEPDRDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHSCIYAAGGYDGQDQLNSVERYDVE
TETWTFVASMKHRRSALGIAVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRLTSG
RSGVGVAVTMEPCRKQIDQQNCTC
Download sequence
Identical sequences XP_006242653.1.100692 10116.ENSRNOP00000028360 ENSRNOP00000028360 ENSRNOP00000028360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]