SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000034717 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000034717
Domain Number 1 Region: 308-398
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.1e-18
Family SPRY domain 0.0018
Further Details:      
 
Domain Number 2 Region: 32-144
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-16
Family V set domains (antibody variable domain-like) 0.00027
Further Details:      
 
Domain Number 3 Region: 151-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000354
Family C1 set domains (antibody constant domain-like) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000034717   Gene: ENSRNOG00000030297   Transcript: ENSRNOT00000029451
Sequence length 399
Comment pep:known chromosome:RGSC3.4:20:4371620:4380643:1 gene:ENSRNOG00000030297 transcript:ENSRNOT00000029451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIYCKPSVLFQDSYLLVLTQLLCWVTTKGFRVFGPSDPVVVAPGREAILPCSVSPAMSV
ENMEELRWFRTRFSEAVFVYRDQEEQKEEQMIEYSLRTSLVKDQFHEGKAAVRIQNVQES
DSGIHVCHFKQGVLYEEAILELKVAAMGSTPEVYIKGPEDGGVCVVCMTSGWYPEPQVHW
RDSTGEDLPASSETLHEDAEGLFSTETSLVLRDSSVRNVACSIFNPVLGQEKAIAIVIPE
PFFPQASPWKAAFIVILTMMGLLVSGTSYLLIREHSGRLKLQQEWSHFQLEKDELQTIKE
DALRTATWRKAQLYADWRREHFQAWTFTLDPASAHPTLVISQDRMRVTRKDTNELFRVLS
IDLFSVLGTKGISSGRYYWEVKLANGEGSKWSLGVCREV
Download sequence
Identical sequences Q6MG94
ENSRNOP00000034717 10116.ENSRNOP00000034717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]