SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000035199 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000035199
Domain Number 1 Region: 453-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 398-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 3-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.53e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 359-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-17
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000035199
Domain Number - Region: 232-262
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00205
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000035199   Gene: ENSRNOG00000023431   Transcript: ENSRNOT00000037116
Sequence length 530
Comment pep:known chromosome:RGSC3.4:10:45150382:45153249:1 gene:ENSRNOG00000023431 transcript:ENSRNOT00000037116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFSLQGLVSFEDVSVDFTWDEWQDLDDAQRKLYREVMLETYSSLLSLNQCDAKPELILKL
EQGAEPWKEDGAADPSLEALQPVKSLKETRWDNRKRHLSHLVITGSASAEERGRFGEIFN
LSSNHVLHLAIKNKDSSRRRAEVLDTWENMCLPGEMQATKELDHPNSAKVPCRPPVPLSL
DLSVESGQQRVQRAQRGEVFDVNTVWTRTVFPLGDSSRNAFDKLALSAREGTRLREETFG
CNMCKESFSDTKHLKPHLKTQRGMSTNGEPASRAKAGLQRTLRAWGKPRGCNGDEKCVHQ
MPKLRADRSVFSGKESNCVKTFCPDSTLSVQRRPHPGKKPRESPVKANDQPRRRHRGGRT
YQCKVCGKAFKHTQNLYLHHRTHTGEKPYECKECKKLFSVKSNLSVHQKTHTGEKPYECN
ICRNAFKRRCDLTIHQRVHTGEKPYECKECRKTFSIKSGLIVHQRIHTGEKPYECNVCGK
RFNQKSNLSTHEKIHTGEKPFECKDCSKAFSVKSYLTIHQKTHLGEKPHS
Download sequence
Identical sequences ENSRNOP00000035199 10116.ENSRNOP00000035391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]