SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000035304 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000035304
Domain Number 1 Region: 200-541
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.77e-112
Family Motor proteins 0.0000000433
Further Details:      
 
Domain Number 2 Region: 3-67
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000314
Family SAM (sterile alpha motif) domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000035304   Gene: ENSRNOG00000012735   Transcript: ENSRNOT00000035541
Sequence length 1352
Comment pep:known chromosome:RGSC3.4:5:58821891:58857497:-1 gene:ENSRNOG00000012735 transcript:ENSRNOT00000035541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWLYECLCEAELAQYYPHFTALGLQKIDELAKVTMKDYSRLGVHDMNDRKRLFQLIKI
IKIMQEDDKAISSPEHPLQARSLYIKPQEFRSGPRRQLHFDSPDSKDKMASNEMGSLSDF
SVNEQKSTYLKVPEHMLPEDSQYQTKIRTPDAAAAAAAMQTDINAPLFASNYFSSKLGNC
DIPVIQRVSHVSGYNYGLPHSCVRQITSENPWTEMEKIRVCVRKRPLGVREVRRGEVNII
TVEDKETLLVHEKKEAVDLTQYILQHVFYFDEVFGEACSNQDVYLKTAHPLIQHIFSGGN
ATCFAYGQTGAGKTYTMIGTHQNPGLYALAAKDIFRQLKISQSRRNLFVWISFYEIYCGQ
LYDLLNRRKRLFAREDSKHVVQIAGLRELQVDSVELLLQVILKGSKERSTGATSVNADSS
RSHAVIQIQIKDSAKRTFGRISFIDLAGSERAADARDSDRQTKMEGAEINQSLLALKECI
RALDQEHTHTPFRQSKLTQVLKDSFIGDAKTCMIANISPSHIATEHTLNTLRYADRVKEL
KKGLKCCASAASRNQTSANSSPKRIQSSPVTLPGDKCSPKKVKLGLQQSLTVAPGPTRVK
AHPLASHAPNIPFASGPKAPGKKSSSQGSPTPEWDMKGSPQRGTMRSGHLTKKGAESAPL
CSEKSQIGSKIAVGWEGRASGPREGLLRVRLPTRGKKVQPVQPVQPVQKELLSRARLLGN
SHHLETTQDSKVGTPAVLAPEAWTNPSLQQKEREEHLRFYHQQFQQPPLLKQKLKYQPLQ
RLLCQHRPSEGQLQNETVFALHSNPENHDGAQAEDLDDSDFSEDSFSHVSSQPTIKKRST
LERSESSFFLHQDREHSPEKQAAERQQCLLFSSEADGSKKGPADSWVYSRDPIISHRKGA
LDQSHSPSMVCSDWSKEGDSASSGPSSPKDNWAEKPSSQVDFVHHRKPGEAQAFDIRLEA
FRDEVPGQAGPGLENELSFPLSHVAVSGSPDQRDRVSTPLREVGENRVTRTPETVNSTTP
FQEDSREQTQLCSANASGLMAPLSMSLLETPSHEDLSSLEQTAQDRAGYGFMAEMVGGPA
AGHTVSSYDPEAALPVSSATECLWLSSSPPDNRPSCDLPALSPSPIHQHSPDNLPNREAR
QNRRPTLLPQNHVDGEPYDDNAAEIELGGSLTFPRKPSSNIHAGVPYSTPFLTSHTGTSD
GVGRPWTQERKHPTGVSWQELASSLDSNKLHYNEDISWLRRKPISRCLESDSPLVPSCSP
KALGTLCPLTPEQAQQVIIRAHQEQLDEMAELDFKEETLMTQMDSNDFEEFVTQLDEIMA
LKSKCIQSLRSQLQLYLTSLGPAAAPKRTVVS
Download sequence
Identical sequences 10116.ENSRNOP00000035304 ENSRNOP00000035304 ENSRNOP00000035304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]