SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000038037 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000038037
Domain Number 1 Region: 636-833
Classification Level Classification E-value
Superfamily Sec7 domain 3.79e-68
Family Sec7 domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 78-138,339-519,958-997,1041-1112
Classification Level Classification E-value
Superfamily ARM repeat 0.000000064
Family Armadillo repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000038037   Gene: ENSRNOG00000026048   Transcript: ENSRNOT00000036156
Sequence length 1807
Comment pep:known chromosome:RGSC3.4:1:251461244:251501236:1 gene:ENSRNOG00000026048 transcript:ENSRNOT00000036156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELSEIEPNVFLRPFLEVIRSEDTTGPITGLALTSVNKFLSCALIDPTHEGTAEGMENMAD
AVTHARFVGTDPASDEVVLMKILQVLRTLLLTPVGTHLTNESVCEIMQSCFRICFEMRLS
ELLRKSAEHTLVDMVQLLFTRLPQFKEEPKSYVGTNLKKLKMRAGGMSDSSKWKKQKRSP
RPPRHTTKVMPGSELPTPNGAALSSNLTGGMPFIEAPTSISSASSEAASTVVSPCTDSGL
ELSSQATSKEDLTDLEQAGSPREITTTEPGSTEIGVSDQLDPQEGAHVEKAQSASVESIP
EVLEECTSPTDHSDSASVHDMDYVNPRGVRFTQSSQKEGTALVPYGLPCIRELFRFLISL
TNPHDRHNSEVMIHMGLHLLTVALESAPVAQCQTLLGLIKDEMCRHLFQLLSVERLNLYA
ASLRVCFLLFESMREHLKFQLEMYIKKLMEIITVENPKMPYEMKEMALEAIVQLWRIPSF
VTELYINYDCDYYCSNLFEDLTKLLSKNAFPVSGQLYTTHLLSLDALLTVIDSTEAHCQA
KVLNTLNQQEKKETARPGFEAVDGSPDTYKSERAASDGKATGVPSDAPGLHFSSGGWLST
EHGKPGCSDLEEAGDSGVDKKTTRKPPRFSCLLPDPRELIEIKNKKKLLITGTEQFNQKP
KKGIQFLQEKGLLTIPMDNTEVAQWLRENPRLDKKMIGEFVSDRKNMDLLESFVSTFSFQ
GLRLDEALRLYLEAFRLPGEAPVIHRLLEVFTEHWRSCNGSPFANSDACFALAYAVIMLN
TDQHNHNVRKQNAPMTLEEFRKNLKGVNGGKDFEQDILEDMYHAIKNEEIVMPEEQTGLV
RENYVWSVLLHRGATPEGIFLRVPPGSYDLDLFTMTWGPTIAALSYVFDKSLEETIIQKA
ISGFRKCAMISAHYGLSDVFDNLIISLCKFTALSSESIENLPSVFGSNPKAHIAAKTVFH
LAHRHGDILREGWKNIMEAMLQLFRAQLLPKAMVEVEDFVDPNGKISLQREETPSNRGES
TVLSFVSWLTLSGPEQSSVRGPSTENQEAKRVALDCIKQCDPEKMITESKFLQLESLQEL
MKALVSVTPDEETYDEEDAAFCLEMLLRIVLENRDRVGCVWQTVRDHLYHLCVQAQDFCF
LVERAVVGLLRLAIRLLRREEISGQVLLSLRILLLMKPSVLSRVSHQVAYGLHELLKTNA
ANIHSGDDWATLFTLLECIGSGVKPPDALQATARADAPDAGAQSDSELPSYHQNDVSLDR
GYTSDSEVYTDHGRPGKMHRSATDADMANSGWLVVGKDDIDNSKPAAGLSRPGPSPLVNQ
YSLTVGLDLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKS
QDKRGKSHKYDSKGNRFKKKPKEGSMLRRPRASSQHATRAGHSDEEEDEGVPASYHTVSL
QVSQDLLDLMHTLHTRAASIYSSWAEEQRHLETGGRKIEADSRTLWAHCWCPLLQGIACL
CCDARRQVRMQALTYLQRALLVHDLQKLDALEWESCFNKVLFPLLTKLLENISPADVGGM
EETRMRASTLLSKVFLQHLSPLLSLSTFAALWLTILDFMDKYMHAGSSDLLSEAVPESLK
NMLLVMDTAEIFHSADARGGSPSALWEITWERIDCFLPHLRDELFKQTVIQDPMPTEPHS
QKPLASTHLTPAAGDPRMPGHPPPPEIPSEVGACDPEKPESTRAASSSSPGSPVASSPSK
QSPAPEGPPPLAQPPLILQPLTSPLQVGVPPMTLPIILNPALIEATSPVPLLATPRPTDP
IPTSEVN
Download sequence
Identical sequences 10116.ENSRNOP00000038037 ENSRNOP00000038037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]