SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000039054 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000039054
Domain Number 1 Region: 2-439
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.18e-103
Family L-arabinose binding protein-like 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000039054
Domain Number - Region: 447-493
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00155
Family TNF receptor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000039054   Gene: ENSRNOG00000031871   Transcript: ENSRNOT00000050315
Sequence length 790
Comment pep:known chromosome:RGSC3.4:12:433716:492093:-1 gene:ENSRNOG00000031871 transcript:ENSRNOT00000050315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNYQIVLAMVYAIEEINRNPHILPNVSLGYDIYNVLFNEWFTLDRCITWISGPKKYMPNY
TCRREMKSIAALTGISWIISSNIRTLLELYRYPQVRVCKLTIGTFDSNLNNHEQFHDIYQ
IAYKDMYLTHGIVSLLNYFHWNWVGLVVSEGRNGFQIISEVRAEMDRNKICVDFVELIRV
SEVSYLPSYLLNPTHLVKSTANVIITYGDSDFLRGFMLYSRKIFVTRKVWIMNSDWDTII
QSQHFILHSFHGSFIFAHHHKETSGYRNFIQTVNPSKYPEDFYLARFWFYSFNCSFADDD
CNTLENCLTNASLHETPGSRFDMVMTEFAHNIYNAVYAVAHSLHKMLLHQVECFVLPGYE
DRNVICLDLHPFLKNMQFTNPAGEQVSLDEKMKLNAEYDILNYWNFPEGLQLKVKVGQFS
PYGPLGQQLSLSEDTIEWPTEITETPRSVCSESCGPGFRKTLLEGKRICCFDCIPCPENE
ISNETDVDQCIQCLDHQYANTAQNHCLQKSMTFLDYEDPIGIGLSCIALCFFALSSLVLG
IFLKQKNTPIVKANNRTLTYVLLIALNFCFLCSFLFGHPNTATCILQQTTFAVVFTVAVS
TVLAKTITVVLAFKITAPGRRIRWLLVTRAPNFIVPICTLIQIILCGVWLGNSPPFIDTD
SRSEHEHIIIMCNKGSVTAFYCVLGYLGALALGSFTLAFLARNLPDTFNEAKFLTFSMLV
FCSVWVTFLPVYHSTKGKDMVVVEVFSILVSSAGLLGCIFAPKCYIILLRPQRNSLQGHR
DKIHYNYKTY
Download sequence
Identical sequences 10116.ENSRNOP00000044944 ENSRNOP00000039054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]