SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000040781 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000040781
Domain Number 1 Region: 3701-3746
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000175
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 2 Region: 2116-2257
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000399
Family Extended AAA-ATPase domain 0.066
Further Details:      
 
Domain Number 3 Region: 2474-2687
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000573
Family ABC transporter ATPase domain-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000040781   Gene: ENSRNOG00000029658   Transcript: ENSRNOT00000051502
Sequence length 4907
Comment pep:known chromosome:RGSC3.4:10:108798876:108804017:1 gene:ENSRNOG00000029658 transcript:ENSRNOT00000051502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKVPPIDTAANPVKRARKETRDDVQKQKPSPVSLATSKDRDQKAELESKLATPVRKSDES
RNTQPEDQKKPGGDRNYAAAAKNKNQQAAALEATKSTHDPGDRVTVCFHAIVSRDFGFNP
DKHRAYVRGGEGLGQKGWTDACEMYYTQDLHDLGSLIEGKMDIPRQSLDKPIPYKYVIHH
GSSSKDSVEYEFIYEQPQKKGEHVNRCLQVDSTLLSSGDWHQYDDIIWMRSPGLLQQAKN
YITDGTRKNLVRGKKQAAVIMLDRIFSVLQSWSAINLQTFMTQFRQFYSVVRVPMIHDGH
ARKWSSLQYEEREVRLNLWEHVKKLMMPFLEGKSGESLPADCPVRSKQILGLSILCMVEA
ADFTVPKKDLDSLCYLLIPSADSPEALHRDLSPVLSIRQRWHAYLITLCFRCIEVGCDRW
LGILPLLHYCMQQSPPRKNSKSQTEDVWAGLEGISFSEFRDKASASQALQLMQNRMALLH
VDEYLFRSWFSLVPLESLSSYLENSEEYLSHMPTRVLDCFQGISYRLRGLGKISKQNIED
VKKVFKILMYLVDMYQDRIFEESLPQIYLTECADLHETVCSITADRQFYQTPALSAELVC
AVLQLSPPEHTEEGLVAKSYEDLVRTTFQEALNTTRKWLRTVFKSPMLSRNFAAVQLSYP
DEMAVWRRLVGINFPEKYGWKGPLLGDMEGRLKQESPRLQISFFCSSHCCDEGPHDSVAR
SIEKCVIEAVSSVCQSQTSVLEGLSCQDLQKFGTLLSAVITKSWPVHNGELVSDVDEIFK
YLLKWPDVRQLFKLCGTNENITNHITKEGRRLMVTAESVFQKVAGELENGTIVVGQLELI
LKYKSQFLGIWDISNQRLQFQEKVYDMKGLLDRRKDDLFFLKREKRYVESLLTQLGRVKH
FVQVELGNIERIHSQDLSNKKLNEAVIKPPNSSFSNRKTHYYLSPDILEMASKLDSLKDS
HVFQDFWHETAELLSNDTLDQDRRELKLSLPDVVDHLYYPCYEKFYKLYMNLRSGEITFA
DVDVIFRDFKDKYDELNVDLKFMCTLDPQDRKGWISQRVRQIKEYHTLYQAVSSAKVIVQ
VRRALGVTGDFSVLNPLLNFADDFEDFRNEKLNQISPQFIKAKELLQDISELRHRCLEEL
ALQTELVHWLHEALKDINELKVFVDLASISAGENDIDVDRVACFHDAVQGYASLLYKLGA
NTDFNEFMNHLQELWRALDNDQHLPDKLKDSARNLEWLKTVKESHGSVELSSLSLATAIN
SRGIYIIQAPKDGQKVSPDTVLHLLLPDDHGYQEAFRKYSTEELKELLNKLMLMSGRKDH
SSNVEVETFSEVFSNMQRLVHVFINLHCAGNMLFRTWTAKVYCCPGGGISMDFGSKLLNQ
LTESGDVIQLLGALCRQMEDFLHEWKTVVAQKRATHFYLNLYTAEQLVYLSSELRKPRPS
EAALMMLSFIKGKCTVQELIQATSACENKAARHCLQEAMRKLPQQLLSESTLMGKLRVIM
TQSLECMSAFLPSCLDLDTLGRCLAHLARLGGSPVERPLPKGLQVGQPNLILCGHSEVLS
AALAIYMQDPMQPLPTFDEVLLCTPGTTIEEVELFLRRCLTLDSQEHKVYSLLFADQLSY
EVGCQAEELFQSLSTQVHREDYQLVILCDAAREHCYIPSTFSQHKVPLVPQAPLPDIQAY
LENHYQVPKQIQSAATVFRDGLCVGIVTSERAGVGKSLYVNTLHKKLKTKLQDETVPLKI
IRLTEPHIDENHVLSALLPFLEKNYQKTPVIFHIDVSTSVQTGIPVFLFKLLILQYLMDI
NGKMWRRNPCHLYVVEIPQAHSVRPKRSSKLNARAPLFKFLDIFPKVTCRPPKEVINMEL
TPKRSHIEPGMDPAEFCSEAFQRPYQYLRRFHQGQNLDAFRYEKDSVEGSPEECLQHFLI
YCGLTNPSWSELRNFAWFLNCQLKDCEASVFCNSAFTGDTLRGFKNFVVTFMVLMARDFA
TPTLQTSDQSPGKHSATIDGVAEEDLAPFSLRKRWESEPHPYVFFNGDRMTMTFIGFHLK
TNSNGYVDAINPSSGNIIKKDVMTKELFDGLKLQRVPFNINFDSLPRHEKLERLCLALGI
EWPSDPDETYELTTDNMLKILAIEMRFRCGIPVIIMGETGCGKTRLIKFLSDLRRGSIEA
ETMKLVKVHGGTTPSMIYSRVKDAERTAFFNKAQHNLETILFFDEANTTDAVSCIKEVLC
DRTVGGEHLNEDSGLHVIAACNPYRKHSQEMIHRLESAGLGYRVGAEETADRLGSIPLRQ
LVYRVHALPPSLIPLVWDFGQLNDSAERLYIQQIVQRLVDSVTVDQRETFVIANVLSASQ
EFMRKRENECGFVSLRDVERCVKVFQWFHDHSNMLLNKLADFLRECCDSTPAFERDPVLW
SLVMAIGVCYHASLEEKAPYRAAIARCLPKPYNSPKVILNEITHVQDLFLRDAPIRSNIA
RNLALKENVFMMVICIELKIPLFLVGKPGSSKSLAKIIVADAMQGQAASSDLFRCLKQVH
LVSFQCSPHSTPQGIISTFKQCARFQQGKDLQQYVSVVVLDEVGLAEDSPKMPLKTLHPL
LEDGCIEDDPAPYKQVGFVGISNWALDPAKMNRGIFVSRGSPNEKELIESAEGICSSDRL
VQDRIRGYFAPFAKAYETVCQKQDKEFFGLRDYYSLIKMVFAKAKASKKGLSPRDIAHAV
LRNFSGKDDIQALSIFTASLPETLYKEEVSTVELIKQNIHPDLQGSSRGLDSADSRYLLV
LTRNYVALQILQQTFFEGQQPEIIFGSSFPQDQEYTQICRNINRVKVCMETGKMVVLLNL
QNLYESLYDALNQYYVYLGGQKYVDLGLGTHRVKCRVHTDFRLIVIEEKDVVYKQFPVPL
INRLEKHYLDMNTVLQGWQKGIVQELQRWAHEFADVKADQFIARHKYSPADVFIGYHSHA
CASVVLQAVERQGCRNLTEELYRKVFEEAKFILLDCATPDAVVRLSGSSLGSFAANRLSQ
EYYYKQQHNSFVDFLLAHLRMDHHECWAVFTEITTFSRLLTSHDCDVLESELRGLAPKPI
VLSLQQFDTEYSFLKDVRSCLRNPARRKILVIQTDFDDGIHSAQLVASAKYSAINEINKT
QGTEDFVFVYFVTKLSRMGSGTPYVGFHGGLWRSVHIDDLRRSTVMASDVTKLQNVTISQ
LFEPVDKPEQEEMETESSKSGEVAEEQMEVEEEGSEEMKRACDLRGCDVIEVLDTTRLVR
SCVQGAVGMLRDQSESCARNMRRVTILLDLLNEESTLNASFLRESKMRLHVLLNKQEENQ
VRSLKEWVTREAANQDALQEAGTFRHTLWKRVQDVVTPILASMISHIDRDGNLELLARPG
SPAWAQDLWMFIYSDIKFLNIPLALNNTRSNSEMPFILVQSHMNLLKDACNAVPFSWRIR
DYLEELWVQAQYITDTEGLSKKFVEIFQKTPLGLYLAQFPTAQQQELLQSYLKDFLLLTM
KVSSREELMFLQMALRSCLSELQVASGTPEEGLSLPWVHLAYQHFRTRLQNFSRILTIHP
QVLSSLSQAAEKHNLAGCEMTLDAFAAMACAEILKGDILKPSPRVWLQLVKNLSMPLELV
CSEGYLQDSGSMTRAIIQEVRALWNRIFSIALFVEHVLLGTESQIPELSPLVTKYVSLLD
KCLEEDSNLKTYRPFAAVMTTLCNCKDKASKKFCRFGIQPCSICQGDAQDPVCLPCDHVY
CLPCIQTWLAPGQMICPYCKTELPDKFSPTVSQNHRKAIEKHAQFRHMCNSFFVDLVSTM
CFKDNIPPQKSVIDTLLSLLFVQKELLRDASQRHREHTKSLSPFDDVVDKTPVIRSVVLK
LLLKYSFHEVKGYIQNYLSQLENKAFLTEDKTELYLLFINCLEDSVYQKTSAGCRNHERV
LREEGHFLRTYSPGLRGSEPVRTASVEYLQEMARVRLCLDLAADFLSELQEGSGKKLAED
KRCFLKHVEQFCTRVNNDWHRVYLVRKLSSQRGMEFVQSFSRQGHPYQWVFPREVLAQQV
RSRDHLSQLDRYLVHGDEYKAVRDAMAKAVLDCKTLDVGNALSTCRSPKDQQTAYLLLAL
YTEVTALYRSRNGSLHPDSKQLEAMNKFINESKILSAPKINRFAKSLVANTLPLLQTRSA
NGSLRVTVTEMAIHVATILLCGQDKVLEPLRNLAFYPFKMVNAFLPTMPEDLLVHAKFWE
GLTNVRWYTCPNGHPCSVGECGQPMEMSICPDCRVPIGGLNHKPSVGFDVIRNNEDRTQT
GHVLGNPQSSGTAEASDRGQSPVVFILTRLLTHLAMLVGAAQTPQALMNIIKPPVQDPQG
FLEQHIQRDLEQLTKILGKSADETTHVVHLILSSLLKEQHQMTLNFTEVLSTKGCRNNWE
KHFGTLLLRELKHLDKTLPAINARISQDERISSNPVTKIIYGDPATFLPHLPQKSVVHCS
KIWSCRTKITVEYLQHIVEQKNGKETVPLLWHFLQKEAELRLVKFLPEILALQRDLVKQF
QNVSEVEFSSIRSFIHSHHSDGLQKLLHDRITVFLSTWNALRRSLETNGEIKLPKDYCRS
DLDLDAKFEVILPRRRGLGLCGTALVSYLISLHNKMVYVVQKLSNEDNSYSVDTSEVADL
HVISYDVERDLNPLILSNCQYQVQQGGETSQEFDLEKIQRQISSRFLQGKPRLTLKGIPT
LVYRRDWNYEHLFMDIKNKMTQNPLPNSAINAISGQLQSYSDACEALSIVEVTLGFLSTA
GGDPSMELNVYIQEVLQMCDQTSQVLKALNRCQLRHIIALWQFLSAHKSERRLRLKKELF
QEVDVKYKEDLSPRHARLLSTFLNEAGLDSFLLELHEMIVLKLRGAQAESSFNPSWSLKD
TLVSYMETKDSDVLTEVESQFPDEILMSSCVSVWKTAATRKWDRQSR
Download sequence
Identical sequences 10116.ENSRNOP00000049006 ENSRNOP00000040781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]