SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000041059 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000041059
Domain Number 1 Region: 52-491
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.85e-104
Family L-arabinose binding protein-like 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000041059
Domain Number - Region: 510-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00836
Family TNF receptor-like 0.013
Further Details:      
 
Domain Number - Region: 607-815
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0235
Family Calcium ATPase, transmembrane domain M 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000041059   Gene: ENSRNOG00000033950   Transcript: ENSRNOT00000049544
Sequence length 852
Comment pep:known chromosome:RGSC3.4:14:1115860:1162570:-1 gene:ENSRNOG00000033950 transcript:ENSRNOT00000049544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCDFTIAYLILKFSLILFRLTEPSCFWRIKSSEETDGDLRSDCGFVLLAFEEPTEENFYN
QLINFRISARKYEFFLVMFFATDELNKNPDLLPNMSLIFSLGDRMCEDTLGVLDQIHSQQ
NHSWHFINYICGLGRRCDIGLTGPSWTTSLKLAVHSMTPKLTILMVFFGPLNSNLRDHEQ
FPYVHQIAIKDTCLPHGMVSLMLQFGWTWVGLIILDNDQGIQFLSDLREEMQRHGICLAF
VNVIPETMEIYRTRAKIYDKQLMTSSAKVVIIYGEMNSTLEVSFRRWAYLGAQRIWVTNS
QWDVIINKTDFSLDFFHGTVTFAHHHSGMIIFRNVMQTISTSNYPVDISHSMLGWNHFNC
SISKNRHSKMDHFTFNNILEWLALHKFDVVLSEEGYNLYNAVYAVTHTYHELILQQVESQ
KVSESKGLFTDCQQVSSLLKTRVFTNPVGELVNMNHRENQCAEYDIFIIWNFPQGLGLKV
KIASYFPCFPHNQQLRTSEDLENTSTNKKKMASSVCSADCHPGFRRIWREEMAACCFVCS
PCPENEISNETNMDQCVNCPEYQYANTEKNKCIQKGVIFLSYEDPLGMALALIAFCFSAF
TAVVLWVFVKYHDTPIVKANNRILSYLLIVSLMFCFLCSFFFIGYPNRATCILQQITFGI
VFTVAISTVLAKTITVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLLQCFLCVIWLAIA
PPFVDIDEHSEHGHIIIVCNKGSVTAFYCVLGYLACLALGSFTIAFLAKNLPDTFNEAKL
LTFSMLVFCAVWVTFLPVYHSTKGKVMVAVEIFSILASSAGMLGCIFAPKVYIILMRPDR
NSIHKIREKSYF
Download sequence
Identical sequences 10116.ENSRNOP00000041059 ENSRNOP00000041059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]