SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000041258 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000041258
Domain Number 1 Region: 3714-3856
Classification Level Classification E-value
Superfamily SET domain 4.84e-48
Family Histone lysine methyltransferases 0.0044
Further Details:      
 
Domain Number 2 Region: 1358-1428
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000144
Family PHD domain 0.0092
Further Details:      
 
Domain Number 3 Region: 1458-1529
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000465
Family PHD domain 0.0084
Further Details:      
 
Domain Number 4 Region: 1598-1662
Classification Level Classification E-value
Superfamily Bromodomain 0.00000615
Family Bromodomain 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000041258
Domain Number - Region: 1319-1371
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000886
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000041258   Gene: ENSRNOG00000015133   Transcript: ENSRNOT00000040881
Sequence length 3859
Comment pep:known chromosome:RGSC3.4:8:47759175:47834586:-1 gene:ENSRNOG00000015133 transcript:ENSRNOT00000040881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDAALQVSAAIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKAS
PRKPRGRPRSGSDRNPAILSDPSVFSPLNKSETKSTDKIKKKDSKSIEKKRGRPPTFPGV
KIKITHGKDIAELTQGSKEDSLKKVKRTPSAMFQQATKIKKLRAGKLSPLKSKFKTGKLQ
IGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQS
PRRIKPVRIIPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIM
PVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTPNSRFSATSCGSSEKSSAASQHSSQ
MSSDSSRSSSPSIDTTSDSQASEEIQALPEERSNTPEVHTPLPISQSPENESNDRRGRRY
SMSERSFGSRTTKKLPTLQSAPQQQTSSSPPPPLLTPPPPLQPASGISDHTPWLMPPTIP
LASPFLPASAAPMQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNF
RPPPLTPEDVGFASGFSASGSAASARLFSPLHSGTRFDIHKRSPILRAPRFTPSEAHSRI
FESVTLPSNRTSSGASSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSTSELSPLT
PPSSVSSSLSIPVSPLAASALNPTFTFPSHSLTQSGESTEKSQRARKQTSAPAEPFSSNS
PALFPWFTPGSQTEKGRKKDTAPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEK
RKKGSDIQSSSALYPVGRVSKEKVAGEDVGTSSSAKKATGRKKSSSLDSGADIAPVTLGD
TTAVKAKILIKKGRGNLEKNNLDLGPTAPSLEKEKTLCLSTPSPSTVKHSTSSIGSMLAQ
ADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVC
RRAAVALGRKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPI
KPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMR
KCQNLQWMPSKAYLQKQTKAVKKKEKKSKATEKKESKESTVVKSSLESAQKAAPPVREEP
APKKSSSEPPPRKPVEEKTEEGGAPPAPAPAPEPKQASTPASRKSSKQVSQPAAVVPPQP
PSTALQKKEAPKAIPSEPKKKQPPPPESGPEQSKQKKVAPRPSIPVKQKPKDKEKPPPVS
KQENAGTLNILNPLLNGISSKQKIPADGVHRIRVDFKEDCEAENVWEMGGLGILTSVPIT
PRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQH
QATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQW
SHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHSKCEGLSGTEDEM
YEILSNLPESVAYTCVNCTERHPAEWRLALEKELQASLKQVLTALLNSRTTSHLLRYRQA
AKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDEQQPLDLEGVKKKMDQGNYVSVLEF
SDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSNNS
GMLPNAVLPPSLDHNYAQWQEREESSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTP
PILSTDRSREDSPELHPPPGIDDNRQCALCLMYGDDSANDAGRLLYIGQNEWTHVNCALW
SAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVF
LDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPESVHVMIGSM
TIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIMECRPPVVEPDINST
VEHDDNRTIAHSPSSFIEASCKDSQSTAAILSPPSPDRPRSQASSSCYCHVISKVPRIRT
PSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPLRSKL
RIMSPVRSGSVYSRSSVSSVPSLGTATDPESSAKATDRAGPLNSSANLGHSTPVSSGSQR
TVVTGGSKTSHLDGSSSSGVKRSSASDLAPKGSSLKGEKNRTPGSKSTDGSAHNTAYSGI
PKLAPQVLNAAPGELNVSKIGTFAEPSTVPFSKETVSYPQLHLRGQRSDRDQHMDSTQSV
KPSPNEDGEIKTLKLPGMGHRPSILHEHVGSSSRDRRQKGKKSSKETCKEKHSSKSFLEP
GQVTTGEEGNLKPEFADEVLTPGFLGQRPCNNVSSDKTGDKILPLSGVPKGQSTQVEGSS
KELQAPRKCSVKVTPLKMESENQSKNTQKESGPGSPAHMESACPAEPASASRSPGAGPGV
QPSPNNTSSQDPQSNNYQNLPEQDRNLMIPDGPKPQEDGSFKRRYPRRSARARSNMFFGL
TPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISS
GGDERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATSRKSSQIPKRNGKENGTE
NLKIDRPEDAGEKEHVIKSAVGHKNEPKLDNCHSVSRVKAQGQDSLEAQLSSLESSRRVH
TSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSS
SELLTLGEGLGLDSNREKDMGLFEVFSQQLPATEPVDSSVSSSISAEEQFELPLELPSDL
SVLTTRSPTVPSQNSSRLAVISDSGEKRVTITEKSVTSTEGDPALLSPGVDPAPEGHMTP
DHFIQGHMDADHISSPPCGSVEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNST
DSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSPVSST
PNVMETNTSVLGPMGSGLTLTTGLNPSLPPSQSLFPPASKGLLSMPHHQHLHSFPAAAQS
SFPPNISSPPSGLLIGVQPPPDPQLLGSEANQRTDLTTTVTTPSSGLKKRPISRLHTRKN
KKLAPSSAPSNIAPSDVVSNMTLINFTPSQLSNHPSLLDLGSLNPSSHRTVPNIIKRSKS
GIMYFEQAPLLPPQSVGGTTATGAGSSTISQDTSHLTSGPVSALASGSSVLNVVSMQTTT
TPTSSTSVPGHVTLANQRLLGTPDIGSISHLLIKASHQSLGIQDQPVALPQSSGMFPQLG
TSQTPSAAAMTAASSICVLPSSQTAGMTAASPPREAEEQYKLQRVNQLLAGKTGTLSLQR
DRDPDSAPGTQPSNFTQTAEAPNGVRLEQNKTLPSAKQASSTSPGSSPSSGQQSGSSSVP
GPTKPKPKVKRIQLPLDKGSGKKHKVSHLRTSSEAHIPHREANPAPQPSVKRTPRADREQ
QEAAGVEQPSQKECGQPAGPATALPEIQATQNPANEQENAEPKAVEEEESSFSSPLMLWL
QQEQKRKESITERKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLS
FAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHL
RKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEA
VGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDS
EVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIED
ASNKLPCNCGAKKCRKFLN
Download sequence
Identical sequences ENSRNOP00000041258 10116.ENSRNOP00000020573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]