SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000042802 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000042802
Domain Number 1 Region: 55-501
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.15e-105
Family L-arabinose binding protein-like 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000042802
Domain Number - Region: 504-557
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00141
Family TNF receptor-like 0.022
Further Details:      
 
Domain Number - Region: 575-696
Classification Level Classification E-value
Superfamily Clc chloride channel 0.0107
Family Clc chloride channel 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000042802   Gene: ENSRNOG00000040164   Transcript: ENSRNOT00000052336
Sequence length 767
Comment pep:known chromosome:RGSC3.4:14:1422465:1432022:-1 gene:ENSRNOG00000040164 transcript:ENSRNOT00000052336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLCAFPITFLILKFSLIYFHLTEPSCFWRIKNSEETDGDLRSDCGFVLLAFEEPIEEN
YYNELINFRIPATKYEFFLVMFFATDEINKNPDLLPNMSLIFNLVGRMCEDTLGLLDEIY
SQENKTSYIINYVCGIELSCDIDLIGPSWTTSLKLAIHSMMPKVFFGPFNSNLIDHDQFP
YIYQIAIKDTCLPHGMVSLMLQFGWTWVGLIISDNDQGIQFLSDLREEMQRHGICLAFVN
VIPETMQRYRTRAKIYDKQLMTSSAKVVIIYGEMNSTLEVSFRRWAYLGVQRIWVMNSQW
DVIINKRDFSLDFFDGTVTFAHHHSGMTIFRNVMQTMNTSKYPIDLSQSMLGWNYFNCSI
SENRHSKTDHFTFNNTLEWLALHKFDMVLSEEGYNLYNAVYAVAHTYHELISQNVESQKV
AEPKGLFTDCQQVASLLKATVFTNPVGELVNMNHRENQCAEYDIFIIWNFPEGLGLKVKI
ASYFPCFPHNQQLHTSEDLEWATEGTLVPSSMCSATCTAGFRKIHQKQTADCCFDCVQCP
ENEVSNETADMEQCARCPDDKYANSEQTYCLQRTVSFLAYEDPLGMALGCMALFFSAITI
LVLVTFVKYKDTPIVKANNCILSYILLISLIFCFLWSLLFMXHPNKATCILQQTTFGVFF
TVAVSAVLAKTVTVVMAFKLTTPGRRMRGMLASGATNLVIPICTLIQLVLYGIWLAISPP
FIDRDIQSEHGKTIIICNKGSVIAFHFVLGYLGSLALGSITVAFLAR
Download sequence
Identical sequences ENSRNOP00000042802 10116.ENSRNOP00000042802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]