SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043024 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043024
Domain Number 1 Region: 1120-1295
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.83e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00078
Further Details:      
 
Domain Number 2 Region: 681-796
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.23e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.0017
Further Details:      
 
Domain Number 3 Region: 445-568
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-24
Family Pleckstrin-homology domain (PH domain) 0.0000145
Further Details:      
 
Domain Number 4 Region: 915-1034
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-20
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 1419-1561
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-19
Family Pleckstrin-homology domain (PH domain) 0.047
Further Details:      
 
Domain Number 6 Region: 7-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.44e-17
Family SAM (sterile alpha motif) domain 0.0000729
Further Details:      
 
Domain Number 7 Region: 581-680
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000503
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 
Domain Number 8 Region: 1012-1112
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000752
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000043024
Domain Number - Region: 1337-1399
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0284
Family Ras-binding domain, RBD 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043024   Gene: ENSRNOG00000002209   Transcript: ENSRNOT00000044580
Sequence length 1694
Comment pep:known chromosome:RGSC3.4:14:50609443:50789829:1 gene:ENSRNOG00000002209 transcript:ENSRNOT00000044580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVSEVNVDIQDFLMSINLEQYLLHFQEFGFYTVKDCTSINDNVLHQIGISPTGHRRRI
LKQLQMIFSKMQDFPIYANVYKTKNGSTPKEQHSAPSSSSNTCIEFSDSVTVHRPGPAPS
EMVTTNVLSEGNCHSSTSHDKLSLSSSDLPCPEEEICQNVDSSQDYLFGRVNVKIDSLIT
QQAVEHTAGEEQTEKVNLVSEDSSKALNTNTECLPSVDHPASETHCGNGTNGVLESFPPS
PFFQFQGEMVVNELYVPSSPIHSPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKSISGSY
FRDRKSITTSAGKSLTLKDANEDNSTSIFPYGETFLFQRLESSKKFTIKEYIFLEQYIQE
DASDVRSKQCLQENIYDSRKEKVSEDKVEDIWIPREDKNNLPQDSASESEYSTVEECFQS
LRRKNSKASKSRTQKAFYLDPFNRHSYPLSSTSENTDPSTIANAISPYACFYGSSAAKVK
SGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNDREMYSKGIIPLTAISTVRAQGDNKFEI
VTTQRTFVFRVEKEEERNDWISVLLSALKSPSLTSQLQAAVAPEKCGYLELRGYKAKIFT
VLRGNSVWLCKTEQDFKSGLGITIIPMNVANVKQIDRAVKQSFEIITPYRSFSFTADSEK
EKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAG
QHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLKKDEEIQMDSPVDK
RKIFITQKYKEGKFRKTFLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGDP
VHCTPYLLAKKAGQSLQMEFLYHNKFSDFPQYDAHSEGGSSQEATQSTFLCDFLYQATAS
ASRVSTEKKLLEETNKKWCVLEGGFLSYYENDRCTTPNGTINISEVICLTVHKEDFYLNT
GPIFIFEIYLPSERVFLFGAKTSQIQRKWTETIAKRFVPFVAENLTEADYDLIGQLFYKD
CHALDQWRKGWFAMDKSSLCFCLQTQEAQEERMHLRRLQELTISTVVQNGEKVDVLLLVE
KGRTLYIHGYTKLDFTVWRNAIEKAAGTDGNTLQDQQLCKNDVPIIVNSCIAFVTQYGLG
CKYIYQKDGDPLSISELLESFKKDARSVKLRVGKHQLEDVTGVLKSFLSDIDDALLTKEL
YPYWVSALDAQDEKQRTDKYRAFICSLPGVNRATLAALIEHLYRVQKCSEINHMNAHNLA
LVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKNTQVSQA
GDLLIEVFAERKEPDCSIIIRVSPVMEAEELTNDILAIKNILPTKGDIWATFEVIENEEL
ERPLHYTENVLEQVLQWSSLAEPGSAYLVVKRFLTIDTIKQCREKSIKEGILKLKEEPSK
ILSGNKFQDRCVVLRDGHLFIYKDPKSTKHEKMFPLRLMKFYLGVKKKMKPPTSWGLTAC
SEKHHWHLCCDSLQAQMEWMASIFIAQHENDIWPPAGKERKRSITKNPKIGGLPLIPIQH
EKNATQARKNIEMARAELERLRLSERHDGDFTDSSLKDRASIIGYCLEHKDEKLRNRARK
HRSFNCLEDTEAEVPPGLPKGYKGLKTVKKTEDRNSKATLEPNNKLPSKVIEELSVVLQR
SRSHPKELPDEQTL
Download sequence
Identical sequences 10116.ENSRNOP00000003014 ENSRNOP00000043024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]