SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043096 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043096
Domain Number 1 Region: 39-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.84e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00088
Further Details:      
 
Domain Number 2 Region: 168-362
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-37
Family Laminin G-like module 0.0061
Further Details:      
 
Domain Number 3 Region: 352-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-35
Family Laminin G-like module 0.0052
Further Details:      
 
Domain Number 4 Region: 569-591,781-944
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-31
Family Laminin G-like module 0.0037
Further Details:      
 
Domain Number 5 Region: 953-1157
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-28
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 6 Region: 576-637
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000144
Family Fibrinogen C-terminal domain-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043096   Gene: ENSRNOG00000031539   Transcript: ENSRNOT00000041670
Sequence length 1292
Comment pep:known chromosome:RGSC3.4:13:1192186:1844445:-1 gene:ENSRNOG00000031539 transcript:ENSRNOT00000041670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSILRLTSILTWLLSGLWHVGLTATNYNCDDPLASFLSPVAYSSSSDITGSTSSAQLNW
RMGTGGWSPADSSAHQWLQLDLGNRVEITAVATQGRYGSADWVTSYHLMFSDTGHNWQQY
KQENSIWTFAGNLNADSVVHHKLLHSVRARFIRFVPMEWNRNGNIGMRVEVYGCSYKSDV
ADFDGQSSLLYRFSQKTMSTLKDVISLKFKSMQGDGVLFHGEGQRGDHITLELQNGRLVL
YLNLDDKKAWLSSITPSAILGSLLDDQHWHSVFLERVGKQVNFTVDRNTQHFWTKGETEV
LDIDYELSFGGIPVPSKPGTFVKKNFHGCIENLYYNGVNIIDLAKRRKHQIYSGNVTFSC
SEPQIVPITFVNSRSSYLFLPGTPQIDGLSVSFQFRTWNEDGLLLSTELSEGSGTLLLIL
ESGTLRLLIKKVTGHGTESLTGRSLNDGRWHSVSINVRRNRVTLTVDNDAVSLAPETSGL
QIYSGNSYYFGGCPDNLTVSQCLNPIKAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLH
IDLCSIKDRCLPNYCEHGGHCTQTWTSFYCNCSDTGYTGATCHNSIYEQSCEIYRHRGNK
AGFFYVDSDGSGPLGPLQVYCNVTEDKIWMTVQHTITELTQVQGSNSEKPYAMTLNYGGS
MEQLEALIDGSEHCEQEVTYRCRRAHLFNTQDEAPFTWWIGRSNERHPYWGGYVPGVQQC
GCGLEESCQEIASNTGFLSSKDHLPVTQIIITNSNRTNSEAAWRIGPLRCYGDRHFWNAV
SFSTEASYLHFSAFHVEFSADISFFFKTTALSGIFLENLGIKGFLRLEMSSPSEVIFAID
VGNSPIELLVQSPYPLNDNQWHYIQAERNIKETLLQVDNLPKNKREVSDQSNFLLQLSSQ
LFIGGTSSRQKGFLGCIRSLHLNGQKIDLEERAKITPGVRPGCPGHCSSYGRNCHNGGKC
VEKHNGYSCDCTNSPFEGPFCQKEMSALFYSGTSVTYMFQEPYPVAKNTSLSSSAIYKDT
APSKEIVTLSFITAQAPALLLYLKFSPQSFLAILLSRNGNLQIHYQLSKVESHVFTVGSE
NLANRRVHEVNMNRNGQELSIQVDQQLFSYNFSPEVEFQTVRSLILGKVTETLVLNPEVT
QANTLGFVGCLSSVQYNHIAPLKAALRHASIAPVTVQGTLTESSCGSMVESYANGVTTVY
SSSDPFGNTDEHEPLTNAIQSDSAFIGGVIAIVTFIAFGVIGIMTHFLYQHKQSHHTNPM
KEKEYPENLDSSFRNDIDLQNTVSDCKREYFI
Download sequence
Identical sequences 10116.ENSRNOP00000048097 ENSRNOP00000043096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]