SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000043161 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000043161
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily DEATH domain 1.12e-20
Family Pyrin domain, PYD 0.01
Further Details:      
 
Domain Number 2 Region: 535-726
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000628
Family 28-residue LRR 0.03
Further Details:      
 
Domain Number 3 Region: 119-345
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000023
Family Tandem AAA-ATPase domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000043161   Gene: ENSRNOG00000030071   Transcript: ENSRNOT00000048710
Sequence length 727
Comment pep:known chromosome:RGSC3.4:1:68225943:68244934:1 gene:ENSRNOG00000030071 transcript:ENSRNOT00000048710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTSGYGLLKHLRKLSDGEFWSFKELLRKEPEKFKLKPISWMKIENASKEELVMLLNTH
YPKQAWDMALSLFLQVNREDLSIMAQKKRRYKQTKYKKFMKTTFQSIWTLESNICIPDRS
YHLIVEHQYRKLQNIFDSESEPVTAVVTGPTGEGKTVFLRKAMLDWASGILWQNRFQYVF
FFSVLSLNNTTELSLAELISSKLPESSETLNDILSDPKKILFILDGFDYLKFDLELRTNL
CNDWRKILPTQIILSSLLQKIMLPESSLLLELGHISLPKIFPLLQYPRDITIQGFSERCL
KTYFISFFNTEKGIEVFENLKSNQMLKLCSNPYLCWMFCSCLKWQFDREEEAYFQAKTDS
VFFTSFMVSAFKSAYASNPPKQNRAQLKSLCTLAVEGMWKQLFVFDSEDLRRNGISESDK
AVWLRMKFLQNHDNHIVFYHPTLQLYFASMFYFLKQDKDTHVPVIGSIPQLLRKIYARDH
TQWLQIGIFLFGLATEQVASLLKPYFGFIQHRDVRQEVMRYLKSLSQRECCEKLERPQNL
FACLRDNKEEKFVREVVDLFEEITVDITNSHVLSIIANHLQKSSKLKKLHLHIQKIYPFH
NNDVLSHCRNAAEYWKKLCHIFVNLHVLDLDSCNFNKQVIEELCNVLSPSPKIPLMAFKL
ESLLCSFMTNFGDGSLFHTLLQLPHLKYLNLYGTNLSNSRIENLCSALRRSTCKVEELLI
VYKCGIN
Download sequence
Identical sequences 10116.ENSRNOP00000043161 ENSRNOP00000043161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]