SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000046390 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000046390
Domain Number 1 Region: 326-404
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.1e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000935
Further Details:      
 
Domain Number 2 Region: 82-167
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.36e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 3 Region: 49-92
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000135
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000046390
Domain Number - Region: 236-241
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00288
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000046390   Gene: ENSRNOG00000029014   Transcript: ENSRNOT00000045659
Sequence length 410
Comment pep:known chromosome:RGSC3.4:14:98259147:98260435:-1 gene:ENSRNOG00000029014 transcript:ENSRNOT00000045659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METEQAEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELHILLQSKNGAVIGKG
GKNIKALRTDYNASVSVPDSSGPERILSISADIXLRLLIHQSLAGGIIGVKGAKIKELQE
NTQTTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLLSESPIKGAQPYDPNFYDET
YDYGGFTMMFDDRRGRPVGFPMRGRGGFDRMPPGQGGRPMPPSRRDYDDMSPRRGPPPPP
PGRGGRGGSRARNLPLPPPPPPPRGGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTW
SPSEWQMAYEPQGGSGYDSYAGGRGSYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQI
RHESGASIKTDEPLEGSEDRIITITGTQDQIQNTQYLLQNSVKQYSGKFF
Download sequence
Identical sequences ENSRNOP00000046390 10116.ENSRNOP00000046390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]