SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000047139 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000047139
Domain Number 1 Region: 248-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-16
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 90-151
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000103
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 353-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000305
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 286-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000135
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000047139   Gene: ENSRNOG00000032447   Transcript: ENSRNOT00000045473
Sequence length 421
Comment pep:known chromosome:RGSC3.4:7:137023788:137031750:-1 gene:ENSRNOG00000032447 transcript:ENSRNOT00000045473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSEQSVAPGAGWEPMSAQLDAAEPGSERGAREEGPWRTAPRPLEHLHSGLEDETLSLQE
KAPSAPWVPAVPQEGDTGDWEMAAALLAAGSQGLVTIKDVSLCFSQEEWRSLDPSQTDFY
GEYVMQENCGIVVSLRFPIPKLDMLPQLEGGEEQWVPDPQDVEGRDIRKVTYAGDGGEPK
GDTPELETEPSRTLSSMSEETVLWNPGQGPSWRSMPSSSTGTLPRPRFLQEDSVSHLLRS
TDTDSLLKPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKSFGRRHHLIRHQKTH
LHDKPSRCPECGKTFRCSSHLASHQRVHADSKSCKGQEIGESPGAQCAPPVPKCHVCTEC
GKSFGRRHHLVRHWLTHTGEKPFHCPRCEKSFGRKHHLDRHLLTHQGQSPGSSWDRGTSA
F
Download sequence
Identical sequences D4A704
NP_001100262.1.100692 NP_001100262.1.4139 ENSRNOP00000047139 10116.ENSRNOP00000047139 ENSRNOP00000047139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]