SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000047460 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000047460
Domain Number 1 Region: 69-508
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.65e-114
Family L-arabinose binding protein-like 0.00058
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000047460
Domain Number - Region: 516-563
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0195
Family TNF receptor-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000047460   Gene: ENSRNOG00000025976   Transcript: ENSRNOT00000042444
Sequence length 861
Comment pep:known chromosome:RGSC3.4:1:62225080:62255875:1 gene:ENSRNOG00000025976 transcript:ENSRNOT00000042444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFSWIFISCFLQIPILAGSYRSSECLVRMNYRLNGKGNVVIVGFFPAFAAYPLNETTDW
RMTKFTRDIMIEFKLRNYQCILAMMFAIEEINSNPYLLSNVSLGFEVNNVPHGQRKTLGK
LFGSLSGYDCAMPNYRIASEKNTAAVLTGPSWAISEYIGTLLDLYKFPQLTFGPFDSLLS
EQRRFSSLYQVAPKDTSLTVGIVSLMLHFHWIWVGLFIIDDHKGAQTLSDLRSEMDKNGV
CTAFVEMIVVTRGSFFTKSWKNQVQILESSSNVIIIYGDSDSLLSLIVNIKQKLLTWKVW
VLISQWDVSKFDDYFMVDSLHGALIFSHHREEIPNFTDFMQKSNPSKYPEDTYLHVLWHI
FFNCSFVKKDCKIVHNCLPNASLGFLPGNIFDMAMSEESYNVYNAVYAVAHSLHEMILNQ
VQFQPHEKGKKMVFFPWQLHPFLRKIQLINQYGCSVVLDYKRKSYVEYDILNFWNFPKGL
GLNVKVGTFFPNAPKEQKLSISSNMIQWATGSTEVPRSVCSESCHPGFRKTYQEGRVVCC
FDCTPCPENEISNETDMDQCVKCPQTHYANIEKTHCLQKTVTFLTYDDPLGKTLCVISLS
FSSLTAAVLGVFLKNRDTPIVKANNLALSYTLLITLMLCFLCPLLFIGRPSTASCILQQN
IFGLLFTMALSTVLAKTITVVIAFKITAPETVRRWLLISRAPNLIIPLCTLLQIFLSGIW
LTTSPPFIDKDVHSEHGHIIIICNKGSAVAFHCSLGYLGALALGSYFMAFLSRNLPDTFN
EAKFLAFSMLVFCSVWITFLPIYHSTKGKTTVAMEVFSILASGTSLLGIIFAPKCHIILL
RSEKNSLQYIKDKTHARRKTP
Download sequence
Identical sequences M0RC83
10116.ENSRNOP00000047460 ENSRNOP00000067193 NP_001092963.1.100692 NP_001092963.1.4139 ENSRNOP00000047460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]