SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000049766 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000049766
Domain Number 1 Region: 34-223,267-516
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 7.32e-74
Family Integrin alpha N-terminal domain 0.00000173
Further Details:      
 
Domain Number 2 Region: 845-1082
Classification Level Classification E-value
Superfamily Integrin domains 1.15e-51
Family Integrin domains 0.00067
Further Details:      
 
Domain Number 3 Region: 516-682
Classification Level Classification E-value
Superfamily Integrin domains 3.56e-30
Family Integrin domains 0.0062
Further Details:      
 
Domain Number 4 Region: 683-835
Classification Level Classification E-value
Superfamily Integrin domains 2.04e-22
Family Integrin domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000049766   Gene: ENSRNOG00000007905   Transcript: ENSRNOT00000048267
Sequence length 1178
Comment pep:known chromosome:RGSC3.4:7:2230747:2269386:1 gene:ENSRNOG00000007905 transcript:ENSRNOT00000048267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARIPRCDFLGLPGICYLLSFLLAGLLLPRASAFNLDVMGAIRKEGEPGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDRGANVQKESKE
NQWLGVSVRSQGAGGKVVTCAHRYESRQRVDQVLETRDVIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHEQFGFCQQGTAATFSPDSHYLIFGAPGTYNWKGTARVELCAQGSSDLAH
LDDGPYQGGENDQDPRLIPVPANSYLGLLFVTNIDSSDPDQLVYKTLDPADRLTGPAGDL
TLNSYLGFSIDSGKGLMRSEELSFVAGAPRANHKGAVVILRKDSASRLIPEVVLSGERLT
SGFGYSLAVTDLNSDGWADLIVGAPYFFERQEELGGAVYVYMNQGGHWADISPLRLCGSP
DSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGVVTKPSQVLEGEAVGIK
SFGYSLSGGLDVDGNHYPDLLVGSLADTAALFRARPVLHVSQEIFIDPRAIDLEQPNCAD
GRLVCVHVKVCFSYVAVPSSYSPIVVLDYVLDGDTDRRLRGQAPRVTFPGRGPDDLKHQS
SGTVSLKHQHDRVCGDTVFQLQENVKDKLRAIVVTLSYGLQTPRLRRQAPDQGLPLVAPI
LNAHQPSTQRTEIHFLKQGCGDDKICQSNLQLAQAQFCSRISDTEFQALPMDLDGTALFA
LSGQPFIGLELTVTNLPSDPARPQADGDDAHEAQLLATLPASLRYSGVRTLDSVEKPLCL
SNENASHVECELGNPMKRGTQVTFYLILSTSGITIETTELKVELLLATISEQDLHPVSVR
AHVFIELPLSISGVATPQQLFFSGKVKGESAMRSERDVGSKVKYEVTVSNQGQSLNTLGS
AFLNIMWPHEIANGKWLLYPMRVELEGGQGPEKKGICSPRPNILHLDVDSRDRRRRELGQ
PEPQEPPEKVEPSTSWWPVSSAEKRNVTLDCAQGTAKCVVFSCPLYSFDRAAVLHVWGRL
WNSTFLEEYMSVKSLEVIVRANITVKSSIKNLLLRDASTVIPVMVYLDPVAVVAEGVPWW
VILLAVLAGLLVLALLVLLLWKLGFFKRAKHPEATVPQYHAVKILREDRQQFKEEKTGTI
QRSNWGNSQWEGSDAHPILAADWHPELGPDGHPVSVTA
Download sequence
Identical sequences 10116.ENSRNOP00000041822 ENSRNOP00000049766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]