SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000052533 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000052533
Domain Number 1 Region: 514-641
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-34
Family SPRY domain 0.0012
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-20
Family RING finger domain, C3HC4 0.008
Further Details:      
 
Domain Number 3 Region: 146-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000136
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000052533   Gene: ENSRNOG00000002341   Transcript: ENSRNOT00000055674
Sequence length 643
Comment pep:known chromosome:RGSC3.4:10:77459844:77476410:1 gene:ENSRNOG00000002341 transcript:ENSRNOT00000055674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELFPLAEELSCSICLEPFKEPVTTPCGHNFCRSCLNETWVVQGPPYRCPQCRTVYQVR
PQLHKNTVLCAVVEQFLQAEQARTPVDDWIPPTRSAASSSDTQVSCDHCLKEVAVKTCLV
CMASFCQEHLRPHIDSPAFQDHPLQPPVRDLLRRKCSRHNRLREMFCPEHGECICHICLV
EHKTCSPTILSQASADLENKLRQKLTIMYSHINGASKALEDVKSKQQNVQESMKRKMLQL
RQEYLEMKAVIDAAETSSTHKLKEEEKRVYGKLDTIYQVLLKKKNEMQNLKAEVELILAK
GDEFEFLEKAAKLQEVSTKPVYIPKIDLDHDLIKGVYQGALDLKSELKLSLKQLQEKKAE
EPCNSGNVGDHAQSTSKPTRPAKKTAPDKKTKKTPGAAGAAGAAGAAGAAGPTSYSSSSN
KLPXLESXGXSXVXLATLKPNAPXPNSAAVKAKVLEXFLTMSRXELLECWMASCIRWMDG
WVDGWVDDGWVDGWVDDGWVDDGWVDDGWVDDGWVNGLMCGKKGIHYWEVELQKNNFCGV
GVCYGSMDRQGPESRLGRNPSSWCVEWFNNKISAWHNNVEKTLPSTKATRVGVLLNCDHG
FVIFFAVTEKVYLMYKFKVDFTEALYPAFWVFSAGTTLSICSK
Download sequence
Identical sequences ENSRNOP00000052533 10116.ENSRNOP00000003186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]