SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000053022 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000053022
Domain Number 1 Region: 388-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.9e-38
Family Calponin-homology domain, CH-domain 0.0000868
Further Details:      
 
Domain Number 2 Region: 86-241,387-436
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.31e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.058
Further Details:      
 
Domain Number 3 Region: 756-789
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000054
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000053022   Gene: ENSRNOG00000012610   Transcript: ENSRNOT00000056176
Sequence length 826
Comment pep:known chromosome:RGSC3.4:4:157420067:157458344:-1 gene:ENSRNOG00000012610 transcript:ENSRNOT00000056176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERKQETTNQAHVLFDRFVQATTCKGTLRAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYTDTELLLSRENVDQEALLNYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNININFLR
PSQVRHLYDSGESKDIHLEMENLVNSRTTPKLTRNESVARSSKLLGWCQRQTDGYSGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEQNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSLSSSDTLDLNAEEKAVLIASTKSPISFLSKLGQT
ISRKRSPKDKKEKDSDGAGKRRKTSQSEEEEPPRSYKGERPTLVSTLTDRRMDAAIGNQN
KVKFMATQLLAKFEENAPAQSTGVRRQGSIKKEFPQNLGGSDTCYFCQKRVYVMERLSAE
GKFFHRSCFKCDYCATTLRLSAYAYDIEDEVLPGRWSSASHHVPVA
Download sequence
Identical sequences ENSRNOP00000053022 10116.ENSRNOP00000017079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]