SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059031 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059031
Domain Number 1 Region: 439-685
Classification Level Classification E-value
Superfamily vWA-like 7.78e-67
Family Trunk domain of Sec23/24 0.00014
Further Details:      
 
Domain Number 2 Region: 687-782
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 9.68e-37
Family beta-sandwich domain of Sec23/24 0.0015
Further Details:      
 
Domain Number 3 Region: 198-457
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 9.42e-35
Family beta-sandwich domain of Sec23/24 0.0055
Further Details:      
 
Domain Number 4 Region: 783-888
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 8.5e-30
Family Helical domain of Sec23/24 0.0031
Further Details:      
 
Domain Number 5 Region: 889-1032
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.2e-28
Family C-terminal, gelsolin-like domain of Sec23/24 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059031   Gene: ENSRNOG00000014872   Transcript: ENSRNOT00000064809
Sequence length 1036
Comment pep:known chromosome:RGSC3.4:2:219987952:220096797:1 gene:ENSRNOG00000014872 transcript:ENSRNOT00000064809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQGYVATPPYSQSQPGMGISPPHYGHYGDPSHVSSPPGMMKPPGPTGATAPSGLLPPG
PLPPGPPQFGPNGAHAAGHPPQRFPGHPPVNNAAPPYASGQPLPQSSYPGPGSTSSVTQL
GSQFGSMQINNYGVGVTPQGQGPPGPQSAGAFQGPPQPTQPSILQPGPQVPPPPPTAMNG
PGASPMSAPAHRQDGLPAPTPLNAQYQPPPPPGQTLGAGYHPQQAANYGPQMGGAQLSYP
GGFPGGPAQMAGPAPQLQRKLDPDSIPSPIQVIENDRATRGGQVYTTNTRGQVPPLVTTE
CMIQDQGHSSPRYIRCTTYCFPCTSDMAKQAQIPLAAVIKPFADIPSNETPLYLVNHGES
GPVRCNRCKAYMCPFMQFIEGGRRYQCGFCSCVNDVPPFYFQHLDHIGRRLDHYEKPELS
LGSYEYVATLDYCRKNKPPNPPAFIFMIDVSYSNIKNGLVKLICEELKTVLKRLPKEEHE
EKSAIRVGFITYNKVLHFFNVKSNLAQPQMMVVTDVGEVFVPLLDGFLVNYEESQSVIHN
LLDQIPEMFADSNENETVFAPVIQAGMEALKAAECPGKLFIFHSSLPTAEAPGKLKNRDD
KKLVNTDKEKILFQPQTAVYESLAKDCVANSCSVTLFLFPSQFVDVASLGLVPLLTGGSL
YKYNVFQVHVDSQRFLNDLRNDIEKKIGFDAIMRVRTSTGFRATDFFGGIFMNNTTDVEM
AAIDCDKAVTVEFKHDDKLSEDVGALIQCALLYTTIGGQRRLRIHNVALNCSTQLADLYK
SCETDALINFFAKSAFKAVLNQPLKTIREILVNQTAHMLACYRKHCASPSAASQLILPDS
MKVLPVYMNSLLKNCVLLSRPEISPDERAYQRQLVMTMGVADSQLFFYPLLLPIHTLDVK
SAALPPAVRCSESRLSEEGIFLLADGLNMFLWFGVGSPAELIQGIFNVPSFAHINTDMAR
TSLPEVGSPHSQQLRMIMNNIQQKKPYSMKLIIVKQREQREMVFRQFLVEDKGLYGGSSY
VDFLCCVHKEICQLLN
Download sequence
Identical sequences 10116.ENSRNOP00000020433 ENSRNOP00000059031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]