SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000059058 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000059058
Domain Number 1 Region: 35-95
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.98e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 2 Region: 287-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 194-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000108
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000059058   Gene: ENSRNOG00000043439   Transcript: ENSRNOT00000066233
Sequence length 369
Comment pep:known chromosome:RGSC3.4:7:113968069:113978711:1 gene:ENSRNOG00000043439 transcript:ENSRNOT00000066233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRCLAAAAAPGEAPLELFSGISSALPERANGDASPQVPVTFREVAVYFCREEWECLSFS
QRTLYRDVMLENFRNLNELGCCGRKPSLISRLEQWDEPWVDKWDSSELERQKSVCPGGRK
ASAPEKTHSRTGAKSKATLRKNVLTSGKAHFTRATSGRKLDNKSEALQNQTCGKSRRRQP
GLKEQGKSAAEGHPFICGICGKALSCHSRLAAHQTVHTGTRSFECFECGQTFRWVSDLLR
HQRTHTSEKPFCCEVCGQAFSRKDCLAQHHKIHTEHRPYVCSDCGKAFSQKSNLLRHKLV
HTGERPFYCDNCGKTFRTKENLNHHQRIHSGEKPYTCGMQELEPEVDCQGKGKKIPQNLL
PPDTWWALE
Download sequence
Identical sequences B1WC07
ENSRNOP00000059058 ENSRNOP00000059058 NP_001129375.1.100692 NP_001129375.1.4139 10116.ENSRNOP00000059058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]