SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060208 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060208
Domain Number 1 Region: 340-632
Classification Level Classification E-value
Superfamily Kelch motif 4.18e-78
Family Kelch motif 0.0000189
Further Details:      
 
Domain Number 2 Region: 68-188
Classification Level Classification E-value
Superfamily POZ domain 9.42e-31
Family BTB/POZ domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060208   Gene: ENSRNOG00000014029   Transcript: ENSRNOT00000067114
Sequence length 654
Comment pep:known chromosome:RGSC3.4:X:10344841:10424664:1 gene:ENSRNOG00000014029 transcript:ENSRNOT00000067114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKWKTSSPASWKFPVPVLKTSRSTPLSPAYISLVEEEDQHLKLCLGSEMGLSSHLQSC
KAGSTRIFTSNSHSSVVLQGFDQLRLDGLLCDVTLMPGDTDDAYPVHRVMMASASDYFKA
MFTGGMKEQELMCIKLHGVSRVGLRKIIDFIYTAKLSLNMDTLQDTLEAASFLQILPVLD
FCKVFLISGVTLDNCVEVGRIANTYHLTEVDKYVNSFVLKNFAALLSTGEFLKLPFERLA
FVLSSNSLKRCTELELFKATCRWLRLEEPRMDVAAKLMKNIRFPLMTPQELINYVQTVDF
MRTDNTCVNLLLEASNYQMMPFMQPVMQSDRTAIRSDTTHLVTLGGVLRQQLVVSKELRM
YDEKTHEWKSLAPMDAPRYQHGIAVIGNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKW
IQVASLNEKRTFFHLSALKGFLYAVGGRNAAGELPTVECYNPRTNEWTYVAKMNEPHYGH
AGTVYGGVMYISGGITHDTFQKELMCFDPDTDKWIQKAPMTTVRGLHCMCTVGDRLYVIG
GNHFRGTSDYDDVLSCEYYSPILDQWTPIASMLRGQSDVGVAVFENKIYVVGGYSWNNRC
MVEIVQKYDPEKNEWHKVFDLPESLGGIRACTLTVYPPEENTPSPSRESPLSGP
Download sequence
Identical sequences ENSRNOP00000060208 ENSRNOP00000060208 XP_006227576.1.4139 XP_006257506.1.100692 XP_017443798.1.4139 XP_017457862.1.100692 10116.ENSRNOP00000060208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]