SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000060665 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000060665
Domain Number 1 Region: 434-617
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-35
Family SPRY domain 0.0032
Further Details:      
 
Domain Number 2 Region: 65-138
Classification Level Classification E-value
Superfamily RING/U-box 3.79e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 199-264
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000458
Family B-box zinc-binding domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000060665   Gene: ENSRNOG00000028812   Transcript: ENSRNOT00000065292
Sequence length 623
Comment pep:known chromosome:RGSC3.4:10:105519578:105527579:1 gene:ENSRNOG00000028812 transcript:ENSRNOT00000065292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQQPQRTVRRRRSPVHRAAKYLAVIDMQKISRPTQDKSPSELSTQSSRTSLQLLMSSNS
SQHLLEDQVLCPICLDVFRNPVTTACGHNFCMTCLQSFWDHQADTGETYYCPQCREAFPS
RPRLCKNVILGEMVACFTLAKSQTSGPLWGLAGPTDVPCDFCSPQKLKATKSCLQCMASL
CEKHLHSHFEDPLFQEHQLLDPVWDLKNRLCRKHRKLRQMYCRTEGSCVCGACLLEEHQN
HDTTPLEDERARKEVEVRKIQANVENQMLIIASDSQKHQGRVSFLSKLIQTMREEVNTCF
SEILHEVKQLQMKVLDFVENEETVALGMLGNSMQQSHSRLLKLEGDSVWLHGLLANKSDE
QFLQEFPTLKHFPACVEPLLGTNCEETQSFLQLPETLAQLRIRLMDIGLNFINQLLLKGI
RMNSYEVLPATVDRKTLLQNYCNLNFDSSMASEELFLFKETHSVLNLGILLEPSTTSPLP
GFKQWPQVLCCPGLSEGCHYWETEVSDSWMCLGVTYRRNPSMSGRHRRNIVYLLGRNPYS
WCLEWDSLKFSVWHNNTQTVLHGSYHHTLGVALDFRAGCLSFYGVAGDVSLLYRFLTSFL
EPLYPAVMVSSGASLTLKQYPEA
Download sequence
Identical sequences ENSRNOP00000060665 10116.ENSRNOP00000060665 ENSRNOP00000060665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]