SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061094 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061094
Domain Number 1 Region: 550-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 592-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 512-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 194-248
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000017
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000061094
Domain Number - Region: 92-173
Classification Level Classification E-value
Superfamily Tropomyosin 0.0196
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061094   Gene: ENSRNOG00000026981   Transcript: ENSRNOT00000065034
Sequence length 666
Comment pep:known chromosome:RGSC3.4:4:76010887:76034986:1 gene:ENSRNOG00000026981 transcript:ENSRNOT00000065034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSTRPQPQQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRAEMAEGMPPMQAQEWD
MDARRPMPFQFPPFPDRAPVFPDRMMREPQLPTAEISLWTVVAAIQAVERKVDAQASQLL
NLEGRTGTAEKKLADCEKTAVEFGNHMESKWAVLGTLLQEYGLLQRRLENLENLLRNRNF
WVLRLPPGSKGEAPKVPVTFVDIAVYFSEDEWKNLDEWQKELYSNLVKENYKTLMSLDTD
GPVSKPDAPVQAEPREEPCVWEQHHPEEREIPGTADTGTEPLVPAQDMSSQVKREEAMCV
RSQRSLEERAIPTESITDSPISAQDLLSRIKQEEQQCVWDQQDLAERDIPTDPNSESLIS
AHDILSWIKQEEQPYPWGPRDSMEGELGLDSGPSDSLLLVKNPPPASAQPQTQPHQQSLP
ALAVPENPGGPGSRSLLEDGFPALPGERSTGGEPQPGGEGSAGGGGGGGSGGGGGTGASS
STSAGAGAGSGCGSCCPGGLRRSLLAHGARSKPYSCLECGKTFGVRKSLIIHHRSHTKER
PYECAECEKSFNCHSGLIRHQMTHRGERPYKCSECEKTYSRKEHLQNHQRLHTGERPFQC
ALCGKSFIRKQNLLKHQRIHTGERPYTCGECGKSFRYKESLKDHLRVHNGPGLGAPRPLQ
VPPERD
Download sequence
Identical sequences D4A4V7
NP_001100062.1.100692 NP_001100062.1.4139 10116.ENSRNOP00000030771 ENSRNOP00000061094 ENSRNOP00000030771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]