SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000061454 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000061454
Domain Number 1 Region: 3821-4001
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-34
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 3223-3337
Classification Level Classification E-value
Superfamily Cadherin-like 4e-30
Family Cadherin 0.00088
Further Details:      
 
Domain Number 3 Region: 1553-1689
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-30
Family Cadherin 0.002
Further Details:      
 
Domain Number 4 Region: 3124-3235
Classification Level Classification E-value
Superfamily Cadherin-like 9.16e-30
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 1140-1245
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-29
Family Cadherin 0.0016
Further Details:      
 
Domain Number 6 Region: 3334-3445
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-29
Family Cadherin 0.00075
Further Details:      
 
Domain Number 7 Region: 2279-2386
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-28
Family Cadherin 0.0014
Further Details:      
 
Domain Number 8 Region: 2807-2915
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 9 Region: 1028-1146
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-27
Family Cadherin 0.00082
Further Details:      
 
Domain Number 10 Region: 3022-3130
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-26
Family Cadherin 0.0016
Further Details:      
 
Domain Number 11 Region: 929-1032
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 12 Region: 145-268
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 13 Region: 1762-1882
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-25
Family Cadherin 0.0016
Further Details:      
 
Domain Number 14 Region: 818-924
Classification Level Classification E-value
Superfamily Cadherin-like 3e-24
Family Cadherin 0.00076
Further Details:      
 
Domain Number 15 Region: 1453-1557
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-24
Family Cadherin 0.00081
Further Details:      
 
Domain Number 16 Region: 2587-2724
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-24
Family Cadherin 0.0038
Further Details:      
 
Domain Number 17 Region: 465-567
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-23
Family Cadherin 0.00096
Further Details:      
 
Domain Number 18 Region: 732-822
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 19 Region: 2071-2179
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-22
Family Cadherin 0.0018
Further Details:      
 
Domain Number 20 Region: 1665-1768
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 21 Region: 2489-2599
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-21
Family Cadherin 0.0038
Further Details:      
 
Domain Number 22 Region: 2916-3021
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-21
Family Cadherin 0.0019
Further Details:      
 
Domain Number 23 Region: 3433-3552
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-21
Family Cadherin 0.0022
Further Details:      
 
Domain Number 24 Region: 2179-2286
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-20
Family Cadherin 0.0022
Further Details:      
 
Domain Number 25 Region: 2386-2486
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-20
Family Cadherin 0.0037
Further Details:      
 
Domain Number 26 Region: 1870-1995
Classification Level Classification E-value
Superfamily Cadherin-like 4.19e-20
Family Cadherin 0.0019
Further Details:      
 
Domain Number 27 Region: 1241-1355
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 28 Region: 1979-2083
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-16
Family Cadherin 0.0025
Further Details:      
 
Domain Number 29 Region: 1360-1459
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000017
Family Cadherin 0.011
Further Details:      
 
Domain Number 30 Region: 570-670
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000186
Family Cadherin 0.0024
Further Details:      
 
Domain Number 31 Region: 2704-2813
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000157
Family Cadherin 0.0039
Further Details:      
 
Domain Number 32 Region: 374-471
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000116
Family Cadherin 0.0078
Further Details:      
 
Domain Number 33 Region: 3546-3636
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000314
Family Cadherin 0.0046
Further Details:      
 
Domain Number 34 Region: 4097-4134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000729
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 35 Region: 4059-4101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family EGF-type module 0.017
Further Details:      
 
Domain Number 36 Region: 4022-4060
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000221
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 37 Region: 278-357
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000124
Family Cadherin 0.01
Further Details:      
 
Domain Number 38 Region: 41-157
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000131
Family Cadherin 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000061454   Gene: ENSRNOG00000011585   Transcript: ENSRNOT00000065272
Sequence length 4555
Comment pep:known chromosome:RGSC3.4:8:12720813:12730436:-1 gene:ENSRNOG00000011585 transcript:ENSRNOT00000065272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVTMRHCIDTRPPSCLIFLLLKLCATVSQGLPGTGPLGFHFTHALYNATVYENSAARTY
VNSQSRMGITLIDLSWDIKYRIVSGDEEGFFKAEEVIIADFCFLRIRTKGGNSAILNREI
QDNYLLIIKGSVRGEDLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQVT
ATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKLY
GNNGVSSTAKLYVHIERINEHAPIIHVVTHTPFSLDKEPTYAVVTVDDLDEGANGEIESV
SIVDGDPLEQFFLAKEGKWMNEYKVKERRQVDWESFSYGYNLTIQAKDKGSPQKFSELKT
VHIANPRRDSTPIKFEKDVYDISISEFSPPGVMVAIVKVNPEPLDVEYTLLPGKDAEYFK
INPRSGLIVTAQPLNTVKKEVYKLEVSDKEGDAKAQVTIGIEDANDHTPEFQETLYETFV
NESVPVGTNVLTVSASDKDKGENGYITYSIASLNLLPFAINQFTGVISTTEELDFESSPE
TYRFIVRASDWGSPYRHESEVNVTIRVGNVNDNSPLFEKVACQGVISYDFPVGGHITAIS
AIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLMNSGIKNGNFALRITATDGENF
ADPMAINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNQEDGFLDFYSINRQ
GPHFDKSFPSDVAVKENMPVGTNILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMETG
QLKVLMPMDREHTDLYVLNITIYDLGKPQKSSWRLLTVNVEDANDNSPVFLQDSYSVSIL
ESSSIGTEIIQVEARDKDLGSNGEVTYSVLTDTHQFVINSSTGIVYIADQLDRESKANYS
LKIEARDKAESGQQLFSVVTLKIFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLETQ
DPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVSL
SSISFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTAHDEDSGRDGEIQYS
IRDGSGLGRFNIDDESGVITAADILDRETTASYWLTVYATDRGVVPLYSTIEVYIEVEDV
NDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSGSNEKLTYRITSGNPQNFFAINIK
TGLITTTSRKLDREQQAEHFLEVTVTDGGSSPKQSTIWVVVQVLDENDNKPQFPEKVYQI
KLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFTA
GSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTIMESDKVTEIV
GVVSVQPANTPLWFDIIGGNFDSSFDAEKGVGTIVIAKPLDAEQRSVYNMSVEVTDGTNV
AVTQVFITVLDNNDNGPEFSQPHYDVTISEDVPPDTEILQIEATDRDEKHKLSYTIHSSI
DAISMRKFRIDPSTGVLYTAERLDHEAQDKHILNIMVRDQEFPYRRNLARVIVNVEDAND
HSPYFTNPLYEASVFESAALGSVVLQVTALDKDKGENAELIYSIEAGNTGNTFKIEPVLG
IITISKEPDMTAMGQFVLSVKVTDQGSPPMSATAIVRISISMSDNSHPKFTHKDYQAEVN
ENVDIGTSVILISAISQSTLIYEVKDGNINGVFTINPYSGVITTRRALDYEHTSSYQLII
QATNMAGMASNATVSVQVVDENDNPPVFLFSQYSGSLSEAAPINSLVRSLDNSPLVIRAT
DADSNQNALLVYQIVESTAKKFFTVDSSTGAIRTIANLDHEVIAHFHFHVHVRDSGNPQL
TAESPVEVNIEVTDVNDNPPVFTQAVFETVLLLPTYVGVEVLKVSATDPDSEVPPELTYS
LMEGSVDHFLMDPNTGVLTIKNNNLSKDHYMLIVRVSDGKFYSTAMVTIMVKEAMDSGLH
FTQSFYSTSISENSTNITKVAIVNAVGNRLNEPLKYSILNPGNKFKIKSTSGVIQTTGVP
FDREEQELYELVVEASRELDHLRVARVVVRVNIEDVNDNSPVFVGLPYYAAVQVDAEPGT
LIYRVTAIDKDKGANGEVTYVLQDDYGHFEINPNSGNVILKEAFNSDLSNIDYGVTILAK
DGGTPSLSTFVELPITIVNKAMPVFDKPFYTASINEDISINTPILSINATSPEGQGIIYL
IIDGDPFQQFNIDFDTGVLKVISPLDYEVMSVYKLTVRASDALTGARAEVTVDLLVDDVN
DNPPVFDQPTYNTTLSESSLIGTPVLQLVSTDADSGNNNLVHYQIVQDTYNSTDYFHIDS
SSGLILTARMLDHELVQHCTLKVTATDNGFPSLSSEVLVQIYISDVNDNPPVFNQLIYES
YVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFLMDSKSGVLTLSSHRKQRM
EPLYSLNVSVSDGLFTSTAQVHIRVLGANLYSPAFSQSTYVAEVRENAASGTKVIHVRAT
DGDPGTYGQVSYSIINDFAKDRFLIDSNGQIITTERLDRENPLEGDISIYLRALDGGGRT
TFCTVRVIVVDENDNAPQFMTLEYRASVRADVGRGHLVTQVQALDPDDGANSRITYSLYS
EASVSVADLLEIDPDNGWMVTKGNFNQLRNTVLSFFVKAVDGGIPVRHSLIPVYIHVLPP
ETFLPSFTQSQYSFTIAEDTSIGSTIDTLRILPNQSVRFSTVNGERPENNKENVFIIEQE
TGAIKLDKRLDHEVSPAFHFKVAATIPLDKVDIVFTVDVDVKVLDLNDNKPVFETSSYET
IIMEGMPVGTKLAQVRAIDTDWGANGQVTYSLHSDSHLEKVMEAFNIDSNTGWISTLKDL
DHETDPTFSFFVVASDLGEAFSLSSMALVSVKVTDINDNAPVFAHEVYRGNVKESDPPGE
VVAVLSTLDKDTSNINRQVSYHITGGNPRGRFALGMVQSEWKVYVKRPLDREEQDIYFLN
ITASDGLFVTQAMVEVTVSDVNDNSPVCDQVAYSASLPEDIPSNKIILKVSAKDADIGSN
GDIRYSLYGSGNSDFFLDPESGELKTLALLDRERVPVYNLIARATDGGGRFCSSTVLLLL
EDVNDNPPVFSSNHYTACVYENTATKALLTRVQAVDPDVGINRKVVYSLEDSASGVFSID
SSSGVIVLEQPLDREQQSSYNISVRATDQSPGQSLSSLTSVTITVLDINDNPPVFERRDY
LVTVPEDTSLGTQVLSVFATSKDIGTNAEITYLIRSGNEQGKFRINPKTGGISVLEALDY
EMCKRFYLVVEAKDGGTPALSTAATVSIDLTDVNDNPPRFSQDVYSAVISEDALEGDSVI
LLIAEDVDSKPNGQIRFSIVGGDRDNEFAVDPILGLVKVKKKLDRERVSGYSLLIQAVDS
GIPAMSSTTTVNIDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDRDSFHNGPP
FSFSILSGNEDEEFMLDSHGILRSAVVFRHMESPEYLLCIQAKDSGKPQQVSHTYIRVRV
IEESTHKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDMYDVLTFALKSEQKSLFKVNSH
DGKIIALGGLDSGKYVLNVSVSDGRFQVPIDVVVHVEQLVHEMLQNTVTIRFENVSPEDF
VGLHMHGFRRILRNAVLTQKQDSLRIISIQPVVGTNQLDMLFAVEMHSSEFYKPAYLIQK
LSNARRHLENVMHIAAILEKNCSGLDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFYR
NVRCTCNGGVCPGSNDPCVEKPCPEDMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSFA
GNSYIKYRLSENSREEDFKLALRLRTLQSNGIIMYTRANPCMILKIVEGKLWFQLDCGSG
PGILGISSRAVNDGSWHSVFLELNRNFTSLSLDDSYVERRRAPLYFQTLSTDSAIFFGAL
VQADNIRSLTDTRVTQVLGGFQGCLDSVVLNHNELPLQNKRSSFAEVVGLTELKLGCVLY
PDACQRSPCLHGGSCSGLPSGGYQCSCLSQFTGTNCESEITACFPNPCRNGGSCDPIGNT
FICSCKAGLTGVTCEDDVDECEREECENGGSCVNLFGSFFCNCTPGYVGQYCGLRPVVVP
NIQAGHSYVGKEELIGIAVVLFVIFTLIVLFIVFRKKVFRKNYSRNNITLVQDPATAALL
HKSNGIPFRSLRAGDGRNVYQEVGPPQVPVRPMAYTPCFQSDSRSNLDKGLDALGGEPQE
LSTFHPESPRILTARRGVVVCSVAPNLPAVSPCRSDCDSIRKNGWDTGSENKGAEDTGEV
TCFANSNKGSNSEVQSLNSFQSDSGDDNAYHWDTSDWMPGARLSDIEEMPNYESQDGGAV
HQGSTRELESDYYLGGYDIDSEYPPPHEEEFLSQDQLPPPLPEDFPEQYEALPPSQPTSL
TGTMSPDCRRRPRFHPSQYLPPHPLPGETDLGGPPSSCDFSTFAVSMNQGTEVMAPTDSV
SLSLHNSRGTSSSDMSARCGFDDSEVAMSDYESAGELSLTNLHIPFVETQHQTQV
Download sequence
Identical sequences F1LMF4
ENSRNOP00000061454 10116.ENSRNOP00000015976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]