SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062842 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062842
Domain Number 1 Region: 206-414
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.86e-40
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 851-1029
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.95e-36
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 449-646
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.77e-35
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 655-845
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.28e-35
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 5 Region: 18-188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.03e-31
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 6 Region: 1062-1202,1231-1273
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-30
Family Laminin G-like module 0.00000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062842   Gene: ENSRNOG00000024722   Transcript: ENSRNOT00000068759
Sequence length 1578
Comment pep:known chromosome:RGSC3.4:6:112346042:113904928:1 gene:ENSRNOG00000024722 transcript:ENSRNOT00000068759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFTLHSVFFTLKVSIFLGSLVGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVS
TGLLLYLDDGGVCDFLCLSLVDGRVQLRFSMDCAETTVLSNKQVNDSSWHFLMVSRDRVR
TGLVIDGEGQSGELRPQRPYMDVVSDLFLGGVPADIRPSALTLDGVQNMPGFKGLMLDLK
YGNSEPRLLGSQSVQLEAEGPCGERPCENGGICFLLDGHPTCDCSTTGYGGTLCSEGLKM
GPCLSHLMMSEQGRYKTREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLI
LHTGKSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTI
SVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIR
LELSRLARIGDTKMKIYGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFR
TTEPNGLILFTHGKPQERKDVRSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKK
ANDGEWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPT
ELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEMQNAAGVKSSCSRMSAKQCDSYPCKNNA
VCKDGWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKVIMPMVMHTEAEDVSFRFMSQ
RAYGLLVATTSRDSADTLRLELDGGRVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEW
HTVRVVRRGKSLKLTVDDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQ
SLMFNGLLYIDLCKNGDIDYCELKARFGLRNIIADPVTFKTKSSYLTLATLQAYTSMHLF
FQFKTTSADGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHN
VVITRDNSNTHSLKVDTKVVTQVINGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQ
GCLASVDLNGRLPDLINDALHRSGQIDRGCEGPSTTCQEDSCANQGVCMQQWEGFTCDCS
MTSYSGNQCNDPGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDS
APGLGDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDN
WPVNEHYPTGNTDNERLQMVKQKIPFKYNRPVEEWLQEKGRQLTIFNTQAQIAIGGKDKG
RLFQGQLSGLYYDGLKVLDLIAKDLNSKKKVTKVRVCPTLPSNKVNNHRTKPPPPTNPRI
LETSTLSSPTFVRTNKSYASAIPTSDDLVSSAECSSDDEDFVECEPSTGRSDKSLSTSIF
EGGYKAHAPKWESKDFRPNKVSETSRTTTTSLSPELIRFTASSSSGMVPKLPAGKMNNRD
LKPQPDIVLLPLPTAYELDSTKLKSPLITSPMFRNVPTANPTEPGIRRVPGASEVIRESS
STTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYISNSAQSNGTLMKEKQA
SSKSGHKKQKNKDKEYYV
Download sequence
Identical sequences ENSRNOP00000062842 10116.ENSRNOP00000047872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]