SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000062987 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000062987
Domain Number 1 Region: 141-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000067
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 2 Region: 187-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000128
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 3 Region: 82-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000062987   Gene: ENSRNOG00000042125   Transcript: ENSRNOT00000064378
Sequence length 319
Comment pep:known chromosome:RGSC3.4:20:43077612:43158788:1 gene:ENSRNOG00000042125 transcript:ENSRNOT00000064378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWNTAWCSVLALWLLWGAVCSNAASGDGNAFPFDIEGSAVVGRQDPSETSDSRVTMGRL
PPAAERCDAGFFRTSSGECSPCDCNGNSHECLDGSGFCLHCQRNTTGEHCERCLAGYIGD
SIRGAPRFCQPCPCPLPHLANFAESCFRKNGAVRCMCKENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEITGQCRNCLRNTTGFKCERCAPGYYGDARIAKNCAV
CNCGGGPCDSVTGECLEEGFELPTGCDKCVWDLTDDLRLAALSIEESKSGLLSVSSGAAA
HRHVTDMNSTIHLLKTKIS
Download sequence
Identical sequences ENSRNOP00000062987 10116.ENSRNOP00000062987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]