SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|19424|e_gw1.1.1143.1 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|19424|e_gw1.1.1143.1
Domain Number 1 Region: 4-266
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-51
Family YWTD domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 325-564
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-46
Family YWTD domain 0.00000684
Further Details:      
 
Domain Number 3 Region: 631-891
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-34
Family YWTD domain 0.000048
Further Details:      
 
Domain Number 4 Region: 936-1177
Classification Level Classification E-value
Superfamily YWTD domain 6.93e-29
Family YWTD domain 0.00018
Further Details:      
 
Domain Number 5 Region: 1295-1333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 587-631
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000481
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1254-1293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000353
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  jgi|Triad1|19424|e_gw1.1.1143.1
Domain Number - Region: 1215-1263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 273-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00223
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|19424|e_gw1.1.1143.1
Sequence length 1355
Sequence
SAGYLIYTNPSEIRIVDTNGKGDRLLISGLHYAVAIDYHLKKKAVYWTDSKTGRISHFNY
KDMSALKNNAHYTALEAKVVPNLQFDSLAGIAVDWINDKLYFIDDDNHRIYVSNLDGTNA
KALFTEGIAYPRAIAVDPLQGYIYWTEWGDKNKIVRAAMDGSAKQIIRSDNMYWPNGLSI
DYLTEKLFFTDGYTKAIYRLDLNGSNFVSIKSNLQHPHDITVHGKRLFWTDWEAFAIQSC
HKTSGKEGRKIITGNKTPLGIKSLAPKHQPRAHNPCGHNNGNCSHLCLISPSQGNNSQST
GYTCACPTGVSFKSGKVCHSGPINFLLITRRSDLRWMSLDAPQFIDVRINIQDIKHAFDV
TYDPVDHYIYWADNIIQAILRAKLDGSGASVIIPNIQSPEGLAIDWIARTIYWTDKIEKK
IEVATLNGTQRKTIIKTDLDTPRAIAIDPFRGYIFWSDWGKVPKIERAYLDGSDRKVIVN
DSIVWPNGIAIDYDKQILYWADADRDTIEISDLNGHGRKTLVKNNLFHVFGLTLQGDYIY
YSDWIKRKVERIHKSNPTTPEVVYHRSDLMGLAAVDLAFYQRAGAGNNTCAHKNGGCSHY
CFFRGSGHICSCPFGYELQEDEKTCFVPNAFFLLLTSKQLYRLSLNDRYDIKKLPINGIQ
GGSGLSFDSRTEEVYWSDIELKQISSSYLNGTNRNVIIEFDLASPNSIAFDWTTKYIYWT
DNILNRIEVTKSDGTARKILIWQDLYKPSYLVIHPKEGLLFWVNHNSNVLDGAKIERSTL
AGTERKTIVEVAGIPVSLEIDFDNDRIFWIDSTRKRIYSASLLGTNLEMIPEFMSSSNFL
SIYEDKLYWIDSKESHIMKANKTNFQREHVHDLRNFDDHPNNLLVYHKNRQKHGSACDKP
RNPCRELCLSISSKDAVCECSTHLVAKGGKCTEPNAYLLFAQQETISKADLDGKSNPHTL
LPIQDMHHQIHSITYDEVQKYYYWIDKNDQGHSVINRAAKSTSELVEYQEVVNEKKQDIY
DIALDSVNRYLFWSSENLHSIQVAKIGEWKSYYAVIGYQYAPRSIAIDPYKSHIYWIHAG
SADSPKIYRCNYDATYSAILIENELYQPTSLTIDISNSSNRLYWIDLGTRTISSARSDGT
NRHDLDFNVKSPINPYSVAIYSKYIYWADLQDSAIYRSYKLPKSPLYAVPQLVFNRLSDL
TGINVVNNFNMKACSNHNCTHLCIVDSYQKSTFRCSCPFGYRILNDSRTCQEIKECGKGE
FKCRSPSISTCINEKSRCDNIINCIDNSDEINCPKCSPFQFHCKNDKCIPWHKKCDGIND
CDDNSDEFSCGRWTSITISLLITVAKMLALIFGYS
Download sequence
Identical sequences B3RKE8
10228.JGI19424 XP_002107786.1.101920 jgi|Triad1|19424|e_gw1.1.1143.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]