SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|27379|e_gw1.7.20.1 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|27379|e_gw1.7.20.1
Domain Number 1 Region: 406-659
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-54
Family YWTD domain 0.00000137
Further Details:      
 
Domain Number 2 Region: 319-398,658-711
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.16e-26
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 150-190
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000628
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 4 Region: 195-233
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000668
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 5 Region: 115-152
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 6 Region: 1-31
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000109
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 71-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000123
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 35-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 9 Region: 232-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 10 Region: 280-315
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|27379|e_gw1.7.20.1
Sequence length 718
Sequence
QFACGNGRCIPIDWRCDGTDDCKDNSDETNCAQVTCHPNNEFTCNDGKCITTSWVCDGQN
DCIDGSDEGSHCLTKTCTPDEFSCGNGVCIKRDYVCDQVDDCGNSADERNCTKVATCSPQ
QFTCNNSHCINSAWRCDNDNDCGDNSDEWNCPNKTCGPELFQCSSGDCIKKSWLCDGERD
CTDGSDEKNCSTSRPKHTCRAGEFQCKNWECIKSEWRCDGSTDCTDGSDELGCNKTTCKS
GQFRCSAHICIDAHNVCDGISDCANSRDEQNCTTPTPPNLTCNSSQFTCHTNKSCISMKL
VCNGKFDCEDKSDEPATCNINECSEYNGHCSQNCVNTKVGYYCACNPGYTLDTDGRTCLD
INECNISNPCSQMCENTKGSYKCTCADGYRLDADFKSCKALGPEPVLFFANRRDIHRFTI
KGSRYNDVMKGLKGAIGIDVHVRKRLLFWTDIVSEKIGRVTLHSNGTVAGKNKYIISDGV
LSPECVAVDWIHDTIYWTDTGLDAIKMSDLDGRYVKTIISNIADPRGLAVDPVDGYIYFT
DWGSSAKIERAKLDGTQRQILVSTNVEWPNGLTIDYPQRKMYWVDGKHHHIESANLDGSG
RRVILSKGIPHPFSITVFENSVYWTDWESKTVETANKLTGANRSVLLSDLYAPMGITTFQ
LQRQPRHYDACHLNKGGCSQICVKTGDYKRTCLCKDGWQLDSDGTGCVLLPSKINIDC
Download sequence
Identical sequences B3S2H0
XP_002114326.1.101920 10228.JGI27379 jgi|Triad1|27379|e_gw1.7.20.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]