SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|49676|fgeneshTA2_pm.C_scaffold_1000136 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|49676|fgeneshTA2_pm.C_scaffold_1000136
Domain Number 1 Region: 151-308
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 3.01e-63
Family DNA-binding protein LAG-1 (CSL) 0.00000158
Further Details:      
 
Domain Number 2 Region: 1-153
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.73e-48
Family DNA-binding protein LAG-1 (CSL) 0.0000434
Further Details:      
 
Domain Number 3 Region: 309-418
Classification Level Classification E-value
Superfamily E set domains 1.12e-28
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|49676|fgeneshTA2_pm.C_scaffold_1000136
Sequence length 460
Sequence
MRKYLAGRCYQSIVILHAKVAQKSYGNEKRFFCPPPCVYLKGDRWKLNRRYIKTNCQNNS
VNGHNDSTHLRAFIGIGNSDQEMQPLSIEENGYGAAKALYISDQDKRKHFQLSVKLYNMD
NNQIIRDIGIFNSKRIKVISKPSKKKQSLKNVDLCIPSGSQVALFNRLRSQTVSTRYLHV
DNDVFHASSQQWGSFTIHLLDSNEDEGVEFTTREGYIQYGSTVKLVCTVTGLALPRLVIR
KVDKQTALLDADDPVSQLHKVAFYMKDTERMYLCLSQERIIQFQATPCPREPNREMINDG
ASWTIISTDEAEYKFYEALGPIDSPVTPVPVVHSLQVIGGGNGASLELTGSNFSDNLKVW
FGDVESETMYRKYHCIVPDIGSFHGGWQFVRQPTKVPVTLVRSDGVTYTTGFNFTYTPEP
GPRSVNETNVNNQSNGIVNVENEEITNTSQFSDCSLLPII
Download sequence
Identical sequences B3RLH1
10228.JGI49676 XP_002107974.1.101920 jgi|Triad1|49676|fgeneshTA2_pm.C_scaffold_1000136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]