SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|52699|fgeneshTA2_pg.C_scaffold_1001446 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Triad1|52699|fgeneshTA2_pg.C_scaffold_1001446
Domain Number - Region: 103-140,170-220
Classification Level Classification E-value
Superfamily Flagellar hook protein flgE 0.0889
Family Flagellar hook protein flgE 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|52699|fgeneshTA2_pg.C_scaffold_1001446
Sequence length 244
Sequence
MCKYTLITILLSLIITRTLGASSTSCCTSGSATYTVVFTGLWANNNNYPNYPTNFPHWSP
LIGAIHSPAVTVYAYGQYASTQVKSVAENGNAVPLKALLEPMTNNVKQVFVSTGSSLQPT
ATYSVTVNVDNNFNLLSALTMIAPSPDWCVGVDRVNFCTSSCGFIASKTIDLYLWDAGTK
AAATEQYSYTGSLTRVPIYQIKTSNQSASVFYRANGQSLLPYARLQLTRVSQNLLSPRKY
SFIA
Download sequence
Identical sequences B3RJW3
XP_002109057.1.101920 jgi|Triad1|52699|fgeneshTA2_pg.C_scaffold_1001446 10228.JGI52699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]