SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|56503|fgeneshTA2_pg.C_scaffold_5000397 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|56503|fgeneshTA2_pg.C_scaffold_5000397
Domain Number 1 Region: 45-259
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-28
Family YWTD domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|56503|fgeneshTA2_pg.C_scaffold_5000397
Sequence length 286
Sequence
MIRRYYIIVYLMIISLCLSSSQDNFFNQFANQAFQFAYKSWNNQNYREVRHLNNIDKPSY
VLATPGGSLYISSFMKNEVYWIPNIYKSQSQAVTLIHGSGLDGPWGMVLDNKILYVASFA
TDEIRKYNSTTGEFINSFGGEQYLDCPEGIVLGSNRTLYVASFLNDKVVKFNLEGDFLGV
VADGSSGLKGPEGVLLMKDGSLLVTSHYSDNILKFNSQTGKFLGEFGKVDRPVGLALGYD
GFVYVTSYSTDSIVILDSSVLPVAELYTVPAMGMIESYQSISHQAL
Download sequence
Identical sequences B3RYB8
jgi|Triad1|56503|fgeneshTA2_pg.C_scaffold_5000397 10228.JGI56503 XP_002112462.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]