SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|57765|fgeneshTA2_pg.C_scaffold_6000745 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|57765|fgeneshTA2_pg.C_scaffold_6000745
Domain Number 1 Region: 840-1092
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-43
Family YWTD domain 0.00000317
Further Details:      
 
Domain Number 2 Region: 515-644
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 616-732
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000863
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 4 Region: 766-801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family EGF-type module 0.046
Further Details:      
 
Domain Number 5 Region: 721-756
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000611
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  jgi|Triad1|57765|fgeneshTA2_pg.C_scaffold_6000745
Domain Number - Region: 808-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000225
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 239-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0248
Family EGF-like domain of nidogen-1 0.026
Further Details:      
 
Domain Number - Region: 316-479
Classification Level Classification E-value
Superfamily GFP-like 0.1
Family Domain G2 of nidogen-1 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|57765|fgeneshTA2_pg.C_scaffold_6000745
Sequence length 1140
Sequence
MATSLDFIQIAQYEYVILKVDYFFYNKHYKTIQVHTNGIITLGTGATSMIAINFNLDSIR
IPIICPFADHIDTRGTGVIYYREDSTEQLLSQVSTNIQKSFTGASTFVAQRAFIATWENV
GFYNSSSTPGNTFQVVIVTDGQRESYAMFLYENDGLRWLRSQPKLGITPRYPLIGFAAGN
GIGSYSLYGSSTANASALPSLSNVDIPGKWLYQIGNGSPGQGGKITPAVLVNGSSVNLCS
MGYPRCSSQSICNNYATGYCCACPNGTKGNGKICYSQIHSMSLADATVQINVQRQNSNTT
LSAQMHGLAYPRSFCRCYLAMSRIPIEEVIVAEVILDELGLLLGWYYADRAVGEPESLAN
GHSLAGDGFHGTSRIHFGLQSAFVLKYSMVPTDANADNILINIETSGLFPDVTQLSNNAT
SNQTDLFAQFEANDQYFYNVAPGKELAIINNHVNLNGTNAIYRTTRFIYHTQCSSDWRAS
GVRVRSTDSYRQFTYDPTRQMVQSTTTFALTNTSGDVNFCALGVHDCDPIAQCFTEPYSY
RCVCPQGYTGDGHVCIDVNECYDGTICQPKSNSYCINTPGSYKCQCFHGYLETANNTCID
LNECSSGINNCSQYANCTNTIASYYCDCWHGYYGDGNNCTFIPCRLCHRDAICTRDRAGD
EICTCKPGYEGDGRLSCRDINECSSPTLNNCSQFASCTNSNGSFSCACLPGYKGNGENCT
DINECVEESYRCVPNSSCDNSIGSFNCSCNDGYRGNPYAPTGNCTDINECEEGSHNCHRY
GICTNSPSTFSCRCETGFIGNGTFCELPCKRCFNGGKCINDTECDCPPGFAGRYCQLNEG
SFLAYAQGYTIQRVNFPANTSDPTVIVHDQYQLGIGIDFDCKENSIYWSNIGGGKSIMKS
DPIGGNVTVVATLNDSSSVEGIAIDSISRTIYWTDSGNDVIEVMKLDGTNRQVLFDTELV
NPRAIAIDPVVGFIFWTDWNRENPRIVRSTADGKDRVNLVVGNLKLPNALTLDTELKRVY
WADAGTNMVEYCSYTGEGRKTLHKGFSTGNSLIYPFALALYGDYLYWSDWSSYDLQRIHR
ITGKLLDPISTKPLGGSYYRIDGIASVIKECSQGANACGSMPIVNCNLCLPGLNNTRTCY
Download sequence
Identical sequences B3S0C6
XP_002113519.1.101920 10228.JGI57765 jgi|Triad1|57765|fgeneshTA2_pg.C_scaffold_6000745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]