SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|58580|fgeneshTA2_pg.C_scaffold_8000128 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|58580|fgeneshTA2_pg.C_scaffold_8000128
Domain Number 1 Region: 10-140,295-446
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.91e-30
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|58580|fgeneshTA2_pg.C_scaffold_8000128
Sequence length 672
Sequence
MATSSFSRQRSADNGASFQRYDQFRNTIISSMAIHSLSPMQLILISKSAKQIYYSSDAGT
TFSNAVKLPFTPSKIVYCNDNSSSNLLGYDAVTTTLYLSKDNGATWNLLRKSVSSSFFWA
LPTFDSDLTTIYYEVLLKVGSKTVARVIAHSISKGIKRIFDASMGYTVKGSLVVSNNYIF
SMKVKSFVNSTEELLLVSYKRNKFIHAKFPVLDLRRGFLLVYTDDNEVVIAVNHALNLTN
VYVSDETGVYYGLAIERIRTSHDFTWLFGSPSVQFRKISSMPGTYIAAQLSNGRSPRPVT
KISYDKGAKWHHVVAPKKDRNGNSINCIAPSCSLHLQFYSRYSFYSSSTSPGLVIGFGNW
GSYFGQRLSSMFISDDGGYTWKEMPFRNAYFTALDHGSVIVAAGYDEIASGTFISYSCDG
GSSWKKLTFSNERIRITGLVVEPGFTSLFATVYGTKVSNEWVLARLNFTSVLARRCQVSD
YRVWIPRNPYTYANCTVGVFMAYHVRKPESCCYNGQTFVRPTTSTRCPCSREDFECNYGF
IPTAHDCSVVSVDQKECDDGANFYYTSKYRKIPGNQCISGVENKLLEKIRYPCSIAFTPA
PNSNGSSMALAIVLPVAVIVIVLIGLVYCKYRRTNEPFLSAIRLRRTVSNPIEALVEDDA
CEEYSSKPSSVV
Download sequence
Identical sequences B3S336
jgi|Triad1|58580|fgeneshTA2_pg.C_scaffold_8000128 XP_002114764.1.101920 10228.JGI58580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]