SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Triad1|58583|fgeneshTA2_pg.C_scaffold_8000131 from Trichoplax adhaerens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Triad1|58583|fgeneshTA2_pg.C_scaffold_8000131
Domain Number 1 Region: 149-264,350-395,429-591
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 8.11e-21
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Triad1|58583|fgeneshTA2_pg.C_scaffold_8000131
Sequence length 815
Sequence
MAKFGLQWFILLCTLGITVASAHQESSTLTYLAKELNEEPEVYEVTLNPDFNNEESIGKV
LAERKSGHSLPVENVFRQRRDNINVQNTVALKNDSNNVAFIFYVGMKTNNTEFILEPTID
SELFYPSVGFRQQIILILTLSRSGSGLVTNSHFYRSTNNGAQFVKSNFFNGKVVRSWTLN
GLDRLKVIFRDARNPRTIYTTSDAGKTISTVNLPFTASTLSYSRVASISGYVAGYDFTKK
ALYVSSNMGATWKSVATNVTRYSWAFGGDDPYRIYYEYTDYNRTTIRYIKTNTMAAGIFD
TKMGPVVPFNLIVSNNYIFTLKSGSARNSTADLLYVSYKRSPFRVANFPVTILNRGFLIL
ETVDNEVVMAVNHKSNLTNLYISDQSGAFFSRTITNILTAPDSSWRRGLAYVGFYRIASL
PGSYMVSQVVGKAPIGFFPPSVTKISYNKGGSWHTIKAPSTDRFGKATNCQLPACSLHIN
FFTGVAILNRGVYTSNAAPGLVLGFGSYGKVFSRANATLYISNDGGFSWAQSSPTSNIFT
ALDHGSVILTAQRGTQRNQTFISYSCNGGKTFTNVKIADQTMTLLTIITEPGSKSLRASV
YGYFHINNYEWIIANLYFQPLLIRKCSENDYINWTPADQYGTKNCLLGSRKVYQVKKPSS
CCFNGADYSRPVSNQNCTCGVEDFECNYGFNALANGTCQIVETYRSQCVSNTSVFTTSVY
RKVPGSSCIGGNQNQYLAKDTYSCVTLAKLSGNGLGAGTYVGIIIGVVVVLLVVVGIYMF
RKNIDEKFSNFRRRKDEYLQEDLDHSVDFSRTEKA
Download sequence
Identical sequences B3S339
jgi|Triad1|58583|fgeneshTA2_pg.C_scaffold_8000131 10228.JGI58583 XP_002114767.1.101920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]